[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for bsub0:CAB12450.2


[Show Plain Result]

## Summary of Sequence Search
   1::469
  16::454  PF00324 0.0% 39.0804597701149  Amino acid permease 
   1::469


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MNQSQSGLKKELKTRHMTMISIAGVIGAGLFVGSGSVIHSTGPGAVVSYALAGLLVIFIMRMLGEMSAVN
PF00324         ---------------hvlvialggviGtglfvglgvvlsqagplgallayllagvviflvmlslgeistn


                         -         -         *         -         -         -         -:140
query           PTSGSFSQYAHDAIGPWAGFTIGWLYWFFWVIVIAIEAIAGAGIIQYWFHDIPLWLTSLILTIVLTLTNV
PF00324         gpkaGgfyayasrslgpelGfviGllylfswifvialeltaasiliqfwelvsdlpkawvtgsvigavfi


                         +         -         -         -         -         *         -:210
query           YSVKSFGEFEYWFSLIKVVTIIAFLIVGFAFIFGFAPGSEPVGFSNLTGKGGFFPEGISSVLLGIVVVIF
PF00324         villiinlvgvkvygeaefilalikviaiiafiivgviillaggkpnkg....rslgyngslkanfppgf


                         -         -         -         +         -         -         -:280
query           SFMGTEIVAIAAGETSNPIESVTKATRSVVWRIIVFYVGSIAIVVALLPWNSANILESPFVAVLEHIGVP
PF00324         akeetgafagfisvfvivffaftGielvaiiagEvknPekaiPkailqaviritifYvlsllaigllvpr


                         -         *         -         -         -         -         +:350
query           AAAQIMNFIVLTAVLSCLNSGLYTTSRMLYSLAERNEAPRRFMKLSKKGVPVQAIVAGTFFSYIAVVMNY
PF00324         ndlglladsasaaspfvifqkssgisvlaplinaviltaalsaansslysasRvlyalakdglaPkkflk


                         -         -         -         -         *         -         -:420
query           FSPDTVFLFLVNSSGAIALLVYLVIAVSQLKMRKKLEKTNPEALKIKMWLFPFLTYLTIIAICGILVSMA
PF00324         kvsksgvPlraillsmiisllalllaslnlaivfnfllaisalinlivwlliilsylrfRkafkyqgrsi


                         -         -         +         -         -         -         -:490
query           FIDSMRDELLLTGVITGIVLISYLVFRKRKVSEKAAANPVTQQQPDILP---------------------
PF00324         eelgfkaclgplfvilvlaaliiillilalyasl------------------------------------