[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for bsub0:CAB13009.1


[Show Plain Result]

## Summary of Sequence Search
   1::218
   1::214  PF05389 0.0% 49.7607655502392  Negative regulator of genetic competence (MecA) 
   1::218


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MEIERINEHTVKFYMSYGDIEDRGFDREEIWYNRERSEELFWEVMDEVHEEEEFAVEGPLWIQVQALDKG
PF05389         MeierinentikvtisldDLeergitledllgnrekieelFyeildevdeeeeFeeegpltfqVlpkekg


                         -         -         *         -         -         -         -:140
query           LEIIVTKAQLSKDGQKLELPIPEDKKQEPASEDLDALLDDFQKEEQAVNQEEKEQKLQFVLRFGDFEDVI
PF05389         levfvtkskesedalkledese.....eeedeeveklleqklekekadekeeeeeeleeekeeskevvle


                         +         -         -         -         -         *         -:210
query           SLSKLNVNGSKTTLYSFENRYYLYVDFCNMTDEEVENQLSILLEYATESSISIHRLEEYGKLIISEHALE
PF05389         FddfedvislakrlkdedleseLYkyegrYYlellfldeelseeeaedllaillEygeesklteevlqey


                         -         -         -         +         -         -         -:280
query           TIKKHFAS--------------------------------------------------------------
PF05389         Gkli------------------------------------------------------------------