[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for bsub0:CAB13082.1


[Show Plain Result]

## Summary of Sequence Search
   1::250
  56::172  PF00005 0.0% 34.5132743362832  ABC transporter 
  38::59   PF02463 0.0% 42.8571428571429  RecF/RecN/SMC N terminal domain 
  74::207  PF02463 0.0% 32.9545454545455  RecF/RecN/SMC N terminal domain 
   1::250


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MEANDQTQNIPAISFRSVRKSYKQDGQTYDVLQDVTGDIQQGAIVAVLGPSGSGKSTLLSMCNLMRTPDS
PF00005         -------------------------------------------------------STLlklltgelkpte
PF02463         -------------------------------------pfsks.ftaivGpNGSGKsnvl-----------
PF02463         -------------------------------------pfsks.ftaivGpNGSGKsnvl-----------


                         -         -         *         -         -         -         -:140
query           GEVNIYGKEVREWNVNELRRTAALAFQSAPVLDGTVRDNLSLVQRLHQSQLYSPEKLASLAGLPPELLDR
PF00005         geievdndrkdlesdkleklr..igyipqdpllfpeltvrenldmakeekk.tdkrieevlekvglde.l
PF02463         ---kingkevtkkevaellesagiske...........................................
PF02463         ---kingkevtkkevaellesagiske...........................................


                         +         -         -         -         -         *         -:210
query           SARDLSGGQRQRLSLARTLSNPSSILLLDEITSALDPVSALEIEELIKRQHQEKKWTVMWVTHNMEQAKR
PF00005         ldksrvstLSgGqkqrvalArallkkpklllL--------------------------------------
PF02463         ...lLSgGektLvalaLlfAiqkvkpaplyllDeidaaLDeknvskvaellkeksknaQfivislre---
PF02463         ...lLSgGektLvalaLlfAiqkvkpaplyllDeidaaLDeknvskvaellkeksknaQfivislre---


                         -         -         -         +         -         -         -:280
query           IADTIWFMADGRLLEIAETDTFFSAPQHEAAKEFLKGGTR------------------------------
PF00005         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------
PF02463         ----------------------------------------------------------------------