[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for bsub0:CAB13391.1


[Show Plain Result]

## Summary of Sequence Search
   1::494
 107::313  PF08245 0.0% 42.4731182795699  Mur ligase middle domain 
 333::418  PF02875 0.0% 38.3720930232558  Mur ligase family, glutamate ligase domain 
 443::490  PF02875 0.0% 20.8333333333333  Mur ligase family, glutamate ligase domain 
  23::95   PF01225 0.0% 45.2054794520548  Mur ligase family, catalytic domain 
   1::494


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKLTKLLTYLTTEPSVNDSQDPEITSIEMDSREVKKGSLFVCVKGYTVDGHDFAQKAVENGAAAIVAERE
PF08245         ----------------------------------------------------------------------
PF02875         ----------------------------------------------------------------------
PF02875         ----------------------------------------------------------------------
PF01225         ----------------------eihfigidsrgmsagalflalkGhkvdGsdfienaiakGAvaVvseai


                         -         -         *         -         -         -         -:140
query           VDVNVPVIIVRQSLRALSVLSDAFYGQPTKKLQLIGITGTNGKTSTTHMVDEILKKAGKRTGLIGTMYMK
PF08245         ------------------------------------iTGTnGKTTtteliaallkaagktvgtag.....
PF02875         ----------------------------------------------------------------------
PF02875         ----------------------------------------------------------------------
PF01225         krdenpevpvipvedraeaLaelaa---------------------------------------------


                         +         -         -         -         -         *         -:210
query           IGDETLPVKNTTPESVTLQKTFKKMNDKHVDTAIMEVSSHALSLGRVHGCDYDIAVFTNLTQDHLDYHKT
PF08245         ..........ntnneiglpallaeleekeadvavlElSsfglgekqlegllkpdiavitnitedHldyhg
PF02875         ----------------------------------------------------------------------
PF02875         ----------------------------------------------------------------------
PF01225         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           MDEYRHAKSLLFSQLGGAFNHEHPKRAVLNADDEASAYFEKVTAAHISTYGIKNDADVMAKNISITAQGT
PF08245         tmenyaaaKsklfenlkekg......iavvnaddealaeaakkkkakvvtfgleeeadleaanlevseeg
PF02875         ----------------------------------------------------------------------
PF02875         ----------------------------------------------------------------------
PF01225         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           SFDLVTNKGTKHITMSLVGQFNVYNVLAAVATCIAAGIPFEIITEAVEELHGVRGRFELVNQQQEFPVIV
PF08245         gkielvkvkgeeleiklplpGrhnveNalaala-------------------------------------
PF02875         ----------------------------------------------------vkgRlevvgeangvtvid
PF02875         ----------------------------------------------------vkgRlevvgeangvtvid
PF01225         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           DYAHTPDSLENVLETCRDMTEGKLFVVVGCGGDRDKTKRPKMAKIAVELADEPIFTSDNPRSEDPRAILR
PF08245         ----------------------------------------------------------------------
PF02875         Dyahnpdslsaalkalreiapdkrlilvfgpggelgertrefhdefgrlasaladslvvlgdypraed--
PF02875         Dyahnpdslsaalkalreiapdkrlilvfgpggelgertrefhdefgrlasaladslvvlgdypraed--
PF01225         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           DMEAGVENAYYHSIANREQAIFFAIANAKKGDVVLIAGKGHETYQQIGNETFDFDDAEVAARAIVELNKN
PF08245         ----------------------------------------------------------------------
PF02875         ----------------------kalreiapdkrlilvfgpggelgertrefhdefgrlasaladslvvlg
PF02875         ----------------------kalreiapdkrlilvfgpggelgertrefhdefgrlasaladslvvlg
PF01225         ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           KTNS------------------------------------------------------------------
PF08245         ----------------------------------------------------------------------
PF02875         ----------------------------------------------------------------------
PF02875         ----------------------------------------------------------------------
PF01225         ----------------------------------------------------------------------