[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for bsub0:CAB13610.1


[Show Plain Result]

## Summary of Sequence Search
   1::442
 143::424  PF00082 0.0% 44.0329218106996  Subtilase family 
   1::442


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MFGYSMVQMVRANAHKLDWPLRETVLQLYKPFKWTPCFLHKFFETKLQNRKKMSVIIEFEEGCHETGFQM
PF00082         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           AGEVLQKEKRSKLKSRFNKINCCSAEVTPSALHSLLSECSNIRKVYLNREVKALLDTATEASHAKEVVRN
PF00082         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           GQTLTGKGVTVAVVDTGIYPHPDLEGRIIGFADMVNQKTEPYDDNGHGTHCAGDVASSGASSSGQYRGPA
PF00082         --gytGkgvvvaviDtGvdpshpdlqkntdgkkklvkvedeegsydfnkndsndpgpveivtsdnaHGth


                         -         -         -         +         -         -         -:280
query           PEANLIGVKVLNKQGSGTLADIIEGVEWCIQYNEDNPDEPIDIMSMSLGGDALRYDHEQEDPLVRAVEEA
PF00082         VAGiiAAngnds.ksvvGvApgAkllavkvldkrgsgteeleaatviraieaav.......knkadvinm


                         -         *         -         -         -         -         +:350
query           WSAGIVVCVAAGNSGPDSQTIASPGVSEKVITVGALDDNNTASSDDDTVASFSSRGPTVYGKEKPDILAP
PF00082         slGealsdsgrvslgsaeialleeavneankkGvivvvaaGNegpdasdtvgvpgpaasttsnvisVgat


                         -         -         -         -         *         -         -:420
query           GVNIISLRSPNSYIDKLQKSSRVGSQYFTMSGTSMATPICAGIAALILQQNPDLTPDEVKELLKNGTDKW
PF00082         dss.................eksneslkvdisApGvnIvSt............pkknnngyqsmsGTSmA


                         -         -         +         -         -         -         -:490
query           KDEDPNIYGAGAVNAENSVPGQ------------------------------------------------
PF00082         sPhv------------------------------------------------------------------