[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for bsub0:CAB13612.1


[Show Plain Result]

## Summary of Sequence Search
   1::150
  39::141  PF02566 0.0% 31.6326530612245  OsmC-like protein 
   1::150


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MADHHFYLKANWPGNRNDVGTIESGNLITSISIPKEMDGPGEGTNPDEMLLGAAATCYIITLAAMMERSG
PF02566         --------------------------------------gggsgpsPeelllaalasClaitlravaakkg


                         -         -         *         -         -         -         -:140
query           LEKEDLQMESEGIVNVTKGVFTYKKIIHRPSVVLKHDASQDDVALAHKLCKKAESSCMISRAIQGNVELQ
PF02566         iklesleveveg..erdpegfrfeeirlkvevkldgadee...eklkrllekaekrCpvsntlkngvkve


                         +         -         -         -         -         *         -:210
query           LEASVKLGGE------------------------------------------------------------
PF02566         v---------------------------------------------------------------------