[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for bsub0:CAB13622.1


[Show Plain Result]

## Summary of Sequence Search
   1::700
 167::684  PF02867 0.0% 38.0855397148676  Ribonucleotide reductase, barrel domain 
   9::89   PF08343 0.0% 59.2592592592593  Ribonucleotide reductase N-terminal 
  91::163  PF00317 0.0% 29.1666666666667  Ribonucleotide reductase, all-alpha domain 
   1::700


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSQNQVPKWIQLNNEIMIQKDGKFQFDKDKEAVHSYFVDYINQNTVFFHNLKEKLDYLVENQYYEEEFLS
PF02867         ----------------------------------------------------------------------
PF08343         --------YieLNneinlydkngkiqlekDkeAleaylkehvnpntvkFdsleekldyLveedyyeeevl
PF00317         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           LYSFEDIKEVFKTAYAKKFRFPSFMSAFKFYNDYALKTNDKKKILERYEDRISIVALFFANGDTEKAKEY
PF02867         ----------------------------------------------------------------------
PF08343         ekYseefieelykkayakk---------------------------------------------------
PF00317         --------------------kltynalkvlearYllkdeng.eivEspqqmfmRvAlalaiaealydkle


                         +         -         -         -         -         *         -:210
query           VNLMINQEYQPSTPTFLNAGRKRRGELVSCFLLEVNDSLNDISRAIDISMQLSKLGGGVSLNLSKLRAKG
PF02867         --------------------------lssCFvlsveDslesIfdtvkeaaklsksgGGvGlnlsklRakg
PF08343         ----------------------------------------------------------------------
PF00317         edkdlaeefydlmssqkflpasP-----------------------------------------------


                         -         -         -         +         -         -         -:280
query           EAIKDVENATKGVVGVMKLLDNAFRYADQMGQRQGSGAAYLNIFHRDINDFLDTKKISADEDVRVKTLSI
PF02867         skirgtggkssGiipflklfddtaeavnqgGkRrGAaavylevwHpDildflelKknegdeerrlknlni
PF08343         ----------------------------------------------------------------------
PF00317         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           GVVIPDKFVELAREDKAAYVFYPHTIYKEYGQHMDEMDMNEMYDKFVDNPRVKKEKINPRKLLEKLAMLR
PF02867         svvvpdlFmkrveededwtlfdpaeakkledlyge.....efeeeyeklekegkivkkkvkareLwkkiv
PF08343         ----------------------------------------------------------------------
PF00317         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           SESGYPYIMFQDNVNKVHANNHISKVKFSNLCSEVLQASQVSSYTDYDEEDEIGLDISCNLGSLNILNVM
PF02867         esaietGePyilfkDavNrknpnkhlgtIkasNlCtEivlltsps............eievCnLasinLa
PF08343         ----------------------------------------------------------------------
PF00317         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           EHKSIEKTVKLATDSLTHVSETTDIRNAPAVRRANKAMKSIGLGAMNLHGYLAQNGIAYESPEARDFANT
PF02867         kfvkekeeafdleelkevvrlavrfLdnvidlndyp.leeieksnkkkRkiGlGvmGladllaklgipyd
PF08343         ----------------------------------------------------------------------
PF00317         ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           FFMMVNFYSIQRSAEIAKEKGETFDQYEGSTYATGEYFDKYVSTDFSPKYEKIANLFEGMHIPTTEDWKK
PF02867         seealeladkifetiayaaikaSvelAkekg.pfenfegskyskgilfidklekkieelsekee......
PF08343         ----------------------------------------------------------------------
PF00317         ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           LKAFVAEHGMYHSYRLCIAPTGSISYVQSSTASVMPIMERIEERTYGNSKTYYPMPGLASNNWFFYKEAY
PF02867         ..ktkedweelrekvkkyglrNsqltaiaPTgtiSliagttesiePifanvysrevksgeflevnpnlsr
PF08343         ----------------------------------------------------------------------
PF00317         ----------------------------------------------------------------------


                         -         +         -         -         -         -         *:700
query           DMDMFKVVDMIATIQQHIDQGISFTLFLKDTMTTRDLNRIDLYAHHRGIKTIYYARTKDTGQDSCLSCVV
PF02867         elkklglweeelvevlaeqgsvqdieeipeeikelyktayeidqkklikmaaar----------------
PF08343         ----------------------------------------------------------------------
PF00317         ----------------------------------------------------------------------