[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for bsub0:CAB14191.1


[Show Plain Result]

## Summary of Sequence Search
   1::233
   1::233  PF01209 0.0% 48.4978540772532  ubiE/COQ5 methyltransferase family 
  52::151  PF08241 0.0% 40  Methyltransferase domain 
  52::149  PF08242 0.0% 26.8041237113402  Methyltransferase domain 
  37::147  PF01135 0.0% 21.6216216216216  Protein-L-isoaspartate(D-aspartate) O-methyltransfe 
  29::151  PF02353 0.0% 20.6896551724138  Cyclopropane-fatty-acyl-phospholipid synthase 
  41::122  PF05175 0.0% 20  Methyltransferase small domain 
  40::110  PF02390 0.0% 21.3114754098361  Putative methyltransferase 
  44::144  PF07021 0.0% 28.7234042553191  Methionine biosynthesis protein MetW 
   1::233


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MQDSKEQRVHGVFEKIYKNYDQMNSVISFQQHKKWRDKTMRIMNVKEGAKALDVCCGTADWTIALAKAAG
PF01209         ktklkeekvkevfesvaskyDlmndvlslgihrlWkkfveklvavkrgakvlDvagGtgDlafklsdsvg
PF08241         ---------------------------------------------------LdvGcGtglllealarr..
PF08242         ---------------------------------------------------LeiGcGtGsllrallek.q
PF01135         ------------------------------------alalellelkkgarvLevGsGsGyltavlarlvg
PF02353         ----------------------------eAqlaK.ldlileklelkpGmtlLdiGcG...WGslvrrave
PF05175         ----------------------------------------etlpkklagkvlDlGcGaGvlgaalakesp
PF02390         ---------------------------------------k.........lvleIGfGsGdflvalAkknP
PF07021         -------------------------------------------likpgsrvldlGcGdGellellkeekq


                         -         -         *         -         -         -         -:140
query           KSGEIKGLDFSENMLSVGEQKVKDGGFSQIELLHGNAMELPFDDDTFDYVTIGFGLRNVPDYLTVLKEMR
PF01209         ekgkvvvlDinenmLkvgekklkeegkinieflqanaeeLpfeddsfDvvtvsfGlrnvtDklkaLkeay
PF08241         paarvtgvDlseemlatakeraekegle...lvvadaeelpfednsfDvvvsshvlehledpekalkeia
PF08242         pdieytgvDispsaiadakeklakrennnnnnvnlealdlldldggssfDvvvasnvlhhlkdirevldn
PF01135         ekgrvvsierikelveeakrnlkkldlenvivvvgDGrkGyeekaPYdaihvgaaapeiPealidQLkeG
PF02353         rydvkvvglTlSkeqaklakqrvdeldlerkvevklldyedldekvdrvvsvgafehvgkenydtff...
PF05175         ele.vtlvDinarAvesakanleanklenvevlasdlleeve.ekkfdlivs------------------
PF02390         dklfl.GiEirqkvvekvlkkiealglkNlrilegdaekv------------------------------
PF07021         vdg..rGleldeegvaecvak....Glsviqgdldkdlen.fedksfdyvvlsqtlqatrnpkevldell


                         +         -         -         -         -         *         -:210
query           RVVKPGGQVVCLETSQPEMFGFRQAYFMYFKYIMPFFGKLFAKSYKEYSWLQESARDFPGMKELAGLFEE
PF01209         rvlkpGGrlvvlefskvelpllsqayelyskevlPvlGkllakdldsyryLvesirafPdqetlkelied
PF08241         RvLkpgGllvi-----------------------------------------------------------
PF08242         irklLkpgG-------------------------------------------------------------
PF01135         GrlvvPv---------------------------------------------------------------
PF02353         kklkkllkedG-----------------------------------------------------------
PF05175         ----------------------------------------------------------------------
PF02390         ----------------------------------------------------------------------
PF07021         rigr------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           AGLKNVKYHSFTGGVAATHIGWK-----------------------------------------------
PF01209         aGfksveyesltgGvvaihigvk-----------------------------------------------
PF08241         ----------------------------------------------------------------------
PF08242         ----------------------------------------------------------------------
PF01135         ----------------------------------------------------------------------
PF02353         ----------------------------------------------------------------------
PF05175         ----------------------------------------------------------------------
PF02390         ----------------------------------------------------------------------
PF07021         ----------------------------------------------------------------------