[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for bsub0:CAB15681.1


[Show Plain Result]

## Summary of Sequence Search
   1::569
 128::438  PF01979 0.0% 26.3888888888889  Amidohydrolase family 
   1::122  PF00449 0.0% 73.5537190082645  Urease alpha-subunit, N-terminal domain 
 129::184  PF07969 0.0% 16.3636363636364  Amidohydrolase family 
 233::436  PF07969 0.0% 20  Amidohydrolase family 
   1::569


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKMSREEYAELFGPTTGDKIRLGDTDLWIEVEKDFTVYGEEMIFGGGKTIRDGMGQNGRITGKDGALDLV
PF01979         ----------------------------------------------------------------------
PF00449         akisreeyaelyGpttgDkvrLadtellievekdltvyGeevkfGggkviRdgmgqsqaakeee.alDlv
PF07969         ----------------------------------------------------------------------
PF07969         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           ITNVVLLDYTGIVKADVGVKDGRIVGVGKSGNPDIMDGVDPHMVIGAGTEVISGEGKILTAGGVDTHIHF
PF01979         ---------------------------------------------------------ivlPGlIDaHvHl
PF00449         itnalilDatGivkadigikdGrivaiGkagnpdimdgvdedlvigastevi------------------
PF07969         ----------------------------------------------------------vlPGFvDsHtHl
PF07969         ----------------------------------------------------------vlPGFvDsHtHl


                         +         -         -         -         -         *         -:210
query           ICPQQMEVALSSGVTTLLGGGTGPATGSKATTCTSGAWYMARMLEAAEEFPINVGFLGKGNASDKAPLIE
PF01979         eqsllreedsyeaiktgakealrsGtTtvldtptsantsvalrkeideglaaapklealvelllkgevgg
PF00449         ----------------------------------------------------------------------
PF07969         dggglnlgraldlsgvg.svaallallrdaaakvghgwdeaqla--------------------------
PF07969         dggglnlgraldlsgvg.svaallallrdaaakvghgwdeaqla--------------------------


                         -         -         -         +         -         -         -:280
query           QVEAGAIGLKLHEDWGTTPSAIKTCMEVVDEADIQVAIHTDTINEAGFLENTLDAIGDRVIHTYHIEGAG
PF01979         raelgevvidraageeeeiegadlikvieaggkgakaidgvlpalaphdaqtvskeelkaevelaeeeee
PF00449         ----------------------------------------------------------------------
PF07969         ----------------------eelvaaaraaglqvavha...sgdaaidavlnayeavlkdg.......
PF07969         ----------------------eelvaaaraaglqvavha...sgdaaidavlnayeavlkdg.......


                         -         *         -         -         -         -         +:350
query           GGHAPDIMKLASYANILPSSTTPTIPYTVNTMDEHLDMMMVCHHLDAKVPEDVAFSHSRIRAATIAAEDI
PF01979         keklgllvhihaaeasgekevvehltgkspverl..............dhllll.knaikggvtllahcl
PF00449         ----------------------------------------------------------------------
PF07969         ................rlehaevattdqidraaelglaadvqphflatdggewvdsrlgpe.rarlslpi
PF07969         ................rlehaevattdqidraaelglaadvqphflatdggewvdsrlgpe.rarlslpi


                         -         -         -         -         *         -         -:420
query           LHDIGAISMTSSDSQAMGRVGEVIIRTWQVADKMKKQRGALAGENGNDNVRAKRYIAKYTINPAITHGLS
PF01979         hld...deairllkergsgvahcplsnesvlhregrksllegdaqgigelgsggarlakvaeeagvk...
PF00449         ----------------------------------------------------------------------
PF07969         aallnaGvkvalgsDapvatldPwlgigaavtrktaeelegrvlkpe.......erlsleealalyTrgp
PF07969         aallnaGvkvalgsDapvatldPwlgigaavtrktaeelegrvlkpe.......erlsleealalyTrgp


                         -         -         +         -         -         -         -:490
query           HEVGSVEKGKLADLVLWDPVFFGVKPELVLKGGMIARAQMGDPNASIPTPEPVFMRQMYASYGKANRSTS
PF01979         lgtD..gvaeelkvalll----------------------------------------------------
PF00449         ----------------------------------------------------------------------
PF07969         AkalgledrkGtlevG------------------------------------------------------
PF07969         AkalgledrkGtlevG------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           ITFMSQASIERGVAESLGLEKRISPVKNIRKLSKLDMKLNSALPKIEIDPKTYQVFADGEELSCQPVDYV
PF01979         ----------------------------------------------------------------------
PF00449         ----------------------------------------------------------------------
PF07969         ----------------------------------------------------------------------
PF07969         ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           PLGQRYFLF-------------------------------------------------------------
PF01979         ----------------------------------------------------------------------
PF00449         ----------------------------------------------------------------------
PF07969         ----------------------------------------------------------------------
PF07969         ----------------------------------------------------------------------