[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for bsub0:CAB15829.1


[Show Plain Result]

## Summary of Sequence Search
   1::82
   7::41   PF06013 0.0% 34.2857142857143  Proteins of 100 residues with WXG 
   1::82


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MNIHEQKITPECLEKAANQVEDKREEYKDVLLQLKKMLGGTTPHSETAEILTRAYEQMKEYALFVQSIET
PF06013         ------kvdpeelrqaAarfqkaaeeleselqrlkaqlaal-----------------------------


                         -         -         *         -         -         -         -:140
query           FLRKSANNLKIK----------------------------------------------------------
PF06013         ----------------------------------------------------------------------