[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for bsub0:CAB12237.1


[Show Plain Result]

## Summary of Sequence Search
   1::420
  29::334  5.6e-61 28.7% 0050959 00509591 1/1   otide-diphospho-sugar transferases      
  45::329  1.7e-55 28.1% 0046833 00468331 1/1   otide-diphospho-sugar transferases      
  45::314  9.7e-54 32.5% 0048604 00486041 1/1   otide-diphospho-sugar transferases      
  10::286    8e-42 32.1% 0046778 00467781 1/1   otide-diphospho-sugar transferases      
  49::259  3.8e-39 29.1% 0042758 00427581 1/1   otide-diphospho-sugar transferases      
  51::316  6.4e-36 24.2% 0052019 00520191 1/1   otide-diphospho-sugar transferases      
   1::420


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MGNTLFFISLSLIWVMLLYHMFLMQGGFRHYMTFERNIPKWRENMKELPKVSVLIPAHNEEVVIRQTLKA
00509591   1/1  ----------------------------drslpdlrpplplpplppsslpkvsviiPtyNeeleylertl
00468331   1/1  --------------------------------------------maa...vsvviptynrpe.lrrtles
00486041   1/1  --------------------------------------------m..mpkvsvviptyNeeeylertles
00467781   1/1  ---------LsllplllpllvglllllfsllllllllllrnlpvlrggrllpldlsslpkvsviIPtyNe
00427581   1/1  ------------------------------------------------PkvSviiptyNeekyleecleS
00520191   1/1  --------------------------------------------------vsVviPayneeetigrvves


                         -         -         *         -         -         -         -:140
query           MVNLYYPKDRLEIIVVNDNSSDRTGDIVNEFSEKYDFIKMVITKPPNAGKGKSSALNSGFAESNGDVICV
00509591   1/1  esllaqtypnfllEiivvDDgStDgtlkeileelaakypdrirvirlpenlG..kaaarnaglkaargdy
00468331   1/1  llaqdytyppfeiivvddgstdetleileelgakdprvrvirlp.npevptnprdknrylGkagarnagl
00486041   1/1  llaqtypd...eiivvddgstdpetleileela.dlr..vrvirlpenl..Gkaaarnaglkaargdyvl
00467781   1/1  eeylercleslhpflnqtyp..nfEiivvDd..........................rleenfGkaaarN
00427581   1/1  llnQtyp..nfEiivvDDgStDgtleilkeya.kdprirvirneldledlsdenlGlaaarnaglklarg
00520191   1/1  laaldyp...veiivvddgStDdTaelarraaaevfsrlgvevrvvlndgplpenpGkgaAlntaleyal


                         +         -         -         -         -         *         -:210
query           YDADNTPEKMAVYYLVLGLMNDEKAGAVVGKFRVINAAKTLLTRFINIETICFQWMAQGGRWKWFKIATI
00509591   1/1  ilflDaDdildpdwlerllaaleenp.vdlvggrrlvidedgqglvrggpllrrllsrllllllrlllga
00468331   1/1  kaalelpkgdyvlflDdDdilspdfleyfeellaaleadpdvgavggr..llnpdgslltrg........
00486041   1/1  flDaDdildpdwlerllaaleenpdv.vvggrvrlinpdgsllrlgrrleyllarlllglglsdllggfa
00467781   1/1  lGikaakglldadyilflDaDdipepdwler...aaleepgvgvvggrillid.................
00427581   1/1  eyiaflDaDdildpdaleklvaaleknpdvdlvggdrliidedglilglsrlllplflllllll......
00520191   1/1  aaargeyvvflDADllsvdpdwlerllepld.dg.ydlVkgyysrraldgrvtrllvrpllnallplayl


                         -         -         -         +         -         -         -:280
query           PGTNFAIRRSIIEKLGGWDDKALAEDTELTIRVYNLGYHIRFFPAAITWEQEPETWKVWWRQRTRWARGN
00509591   1/1  rlsddlgdltapgevpflsggfllfrrealeevggfderlflyggeDvdlslrllraGyrivyvpealvy
00468331   1/1  ......glsllgrvpflsgagllirrealeevggrfderl..eDvdlslrllraGykivyvpealvyh..
00486041   1/1  lsgagllklfrrealeelggfderlfgeDidlglrl...gyrivyvpealvyhrqrsslksllrqrlrws
00467781   1/1  ...........lgvptvsggnllirreafekvGGfderffgwggEDvdlslRlrkaGykivyvpealgrv
00427581   1/1  ..sdlsgstllfrrelleevgglllllllfdedlryaeDydlwlrllka---------------------
00520191   1/1  .....sgfrqplgGefafrrealeavggfeellivsdwgeDidllirlvdlGlrihkvkdpaaglsrmal


                         -         *         -         -         -         -         +:350
query           QYVVLKFLAQFFKLKRKRIIFDLFYFFFTYFLFFFGVIMSNAIFVVNLFYDLHLSVGFLAMILWILAFFL
00509591   1/1  hreresssslsslkqrlrwlrgllrlllkhlkllklllylllllllllllllll----------------
00468331   1/1  pgsssvllsqrlrwalgfiqllrlllkflkknlvyllkllylrillgll---------------------
00486041   1/1  rgllhlllrhk....clnklasifglmpllysll------------------------------------
00467781   1/1  yhlehs----------------------------------------------------------------
00427581   1/1  ----------------------------------------------------------------------
00520191   1/1  qvlktllrlmatfgavwssikktvavpfrglkatyl----------------------------------


                         -         -         -         -         *         -         -:420
query           FMTEVMITLSIEKTEMNKQNFFIVFLMYFTYSQAWIVLVIYSLFVEIKHRLFKQEVKWYKTERYNQHKSG
00509591   1/1  ----------------------------------------------------------------------
00468331   1/1  ----------------------------------------------------------------------
00486041   1/1  ----------------------------------------------------------------------
00467781   1/1  ----------------------------------------------------------------------
00427581   1/1  ----------------------------------------------------------------------
00520191   1/1  ----------------------------------------------------------------------