[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for bsub0:CAB13082.1


[Show Plain Result]

## Summary of Sequence Search
   1::250
  10::245  4.6e-56 39.5% 0037898 00378981 1/1   p containing nucleoside triphosphate hy 
  11::231  1.2e-55 40.0% 0042280 00422801 1/1   p containing nucleoside triphosphate hy 
  10::246  3.2e-55 39.4% 0042070 00420701 1/1   p containing nucleoside triphosphate hy 
  15::227  5.5e-55 38.3% 0039041 00390411 1/1   p containing nucleoside triphosphate hy 
  11::238  2.4e-54 40.1% 0037958 00379581 1/1   p containing nucleoside triphosphate hy 
  13::245  2.4e-54 36.0% 0050943 00509431 1/1   p containing nucleoside triphosphate hy 
  13::246  7.7e-54 37.4% 0049080 00490801 1/1   p containing nucleoside triphosphate hy 
  11::246  1.2e-53 38.0% 0051025 00510251 1/1   p containing nucleoside triphosphate hy 
   1::242  6.4e-53 40.5% 0044086 00440861 1/1   p containing nucleoside triphosphate hy 
  20::249  1.8e-52 36.6% 0048220 00482201 1/1   p containing nucleoside triphosphate hy 
  13::231  3.6e-52 39.2% 0036790 00367901 1/1   p containing nucleoside triphosphate hy 
  11::246  6.5e-52 36.8% 0045860 00458601 1/1   p containing nucleoside triphosphate hy 
  13::246  8.1e-52 38.3% 0042557 00425571 1/1   p containing nucleoside triphosphate hy 
  20::250  5.7e-51 36.0% 0048226 00482261 1/1   p containing nucleoside triphosphate hy 
   4::250  6.4e-51 35.3% 0036121 00361211 1/1   p containing nucleoside triphosphate hy 
  14::244  1.5e-50 39.5% 0040410 00404101 1/1   p containing nucleoside triphosphate hy 
  20::238    5e-50 37.6% 0047599 00475991 1/1   p containing nucleoside triphosphate hy 
  13::248  5.9e-50 36.7% 0053059 00530591 1/1   p containing nucleoside triphosphate hy 
  20::247  2.2e-49 36.9% 0050044 00500441 1/1   p containing nucleoside triphosphate hy 
  20::250  2.8e-49 35.7% 0050274 00502741 1/1   p containing nucleoside triphosphate hy 
  11::219  2.3e-48 38.7% 0043607 00436071 1/1   p containing nucleoside triphosphate hy 
  20::237  3.7e-48 37.3% 0047589 00475891 1/1   p containing nucleoside triphosphate hy 
  23::245  3.3e-47 36.1% 0048545 00485451 1/1   p containing nucleoside triphosphate hy 
  10::246  3.5e-47 38.6% 0046869 00468691 1/1   p containing nucleoside triphosphate hy 
  31::231  5.5e-47 38.5% 0046693 00466931 1/1   p containing nucleoside triphosphate hy 
  20::232  2.8e-46 39.6% 0046697 00466971 1/1   p containing nucleoside triphosphate hy 
   1::237  4.2e-46 37.6% 0037230 00372301 1/1   p containing nucleoside triphosphate hy 
  11::232  5.2e-46 39.0% 0042496 00424961 1/1   p containing nucleoside triphosphate hy 
  11::240  1.1e-45 42.1% 0046945 00469451 1/1   p containing nucleoside triphosphate hy 
  12::213  1.2e-43 36.1% 0043651 00436511 1/1   p containing nucleoside triphosphate hy 
  15::247  1.2e-43 38.1% 0049611 00496111 1/1   p containing nucleoside triphosphate hy 
  10::238  1.5e-43 37.8% 0049825 00498251 1/1   p containing nucleoside triphosphate hy 
  31::238  6.8e-43 40.8% 0049537 00495371 1/1   p containing nucleoside triphosphate hy 
  12::239    9e-43 36.0% 0048852 00488521 1/1   p containing nucleoside triphosphate hy 
  12::237  1.3e-42 35.2% 0036748 00367481 1/1   p containing nucleoside triphosphate hy 
  13::245  2.1e-39 36.1% 0037960 00379601 1/1   p containing nucleoside triphosphate hy 
  40::248  3.2e-39 37.8% 0045731 00457311 1/1   p containing nucleoside triphosphate hy 
  31::226  3.7e-39 37.3% 0050337 00503371 1/1   p containing nucleoside triphosphate hy 
  11::238  9.8e-38 37.2% 0050061 00500611 1/1   p containing nucleoside triphosphate hy 
  13::244  1.1e-37 33.3% 0042214 00422141 1/1   p containing nucleoside triphosphate hy 
  12::246  2.7e-37 31.9% 0037163 00371631 1/1   p containing nucleoside triphosphate hy 
  34::242  3.6e-37 33.2% 0046860 00468601 1/1   p containing nucleoside triphosphate hy 
  32::242  7.7e-37 35.2% 0044893 00448931 1/1   p containing nucleoside triphosphate hy 
  40::247    1e-35 36.3% 0041412 00414121 1/1   p containing nucleoside triphosphate hy 
   1::238  3.4e-35 36.4% 0049503 00495031 1/1   p containing nucleoside triphosphate hy 
  37::241  1.3e-34 32.1% 0048593 00485931 1/1   p containing nucleoside triphosphate hy 
  29::246  3.4e-34 38.9% 0053253 00532531 1/1   arboxykinase-like                       
  10::227  3.7e-33 35.3% 0046479 00464791 1/1   p containing nucleoside triphosphate hy 
  31::225  2.6e-32 30.6% 0047537 00475371 1/1   p containing nucleoside triphosphate hy 
  42::191  8.4e-32 42.5% 0038144 00381441 1/1   p containing nucleoside triphosphate hy 
   9::237  3.1e-30 31.2% 0043798 00437981 1/1   p containing nucleoside triphosphate hy 
  40::223  3.9e-30 34.4% 0042605 00426051 1/1   p containing nucleoside triphosphate hy 
   6::238  9.3e-27 30.0% 0043794 00437941 1/1   p containing nucleoside triphosphate hy 
   7::245  9.9e-27 27.6% 0036850 00368501 1/1   p containing nucleoside triphosphate hy 
  26::229  1.6e-26 32.8% 0046276 00462761 1/1   p containing nucleoside triphosphate hy 
  15::246  1.3e-25 33.3% 0050374 00503741 1/1   p containing nucleoside triphosphate hy 
  36::176  6.9e-25 43.0% 0048047 00480471 1/1   p containing nucleoside triphosphate hy 
  16::248  3.5e-24 27.7% 0048957 00489571 1/1   p containing nucleoside triphosphate hy 
  43::231  3.5e-24 32.7% 0051289 00512891 1/1   p containing nucleoside triphosphate hy 
  28::210  6.4e-24 35.9% 0047841 00478411 1/1   arboxykinase-like                       
  41::239  1.8e-23 29.9% 0049343 00493431 1/1   p containing nucleoside triphosphate hy 
  29::203    2e-23 42.7% 0047552 00475521 1/1   arboxykinase-like                       
  45::216  3.5e-23 32.7% 0036857 00368571 1/1   p containing nucleoside triphosphate hy 
  37::225  5.1e-23 30.6% 0051056 00510561 1/1   p containing nucleoside triphosphate hy 
  41::197  6.5e-23 37.0% 0051553 00515531 1/1   p containing nucleoside triphosphate hy 
  37::225  2.1e-22 31.4% 0046895 00468951 1/1   p containing nucleoside triphosphate hy 
  34::224  2.3e-22 29.5% 0049073 00490731 1/1   p containing nucleoside triphosphate hy 
  41::194  5.5e-22 35.1% 0051551 00515511 1/1   p containing nucleoside triphosphate hy 
  17::240  9.8e-22 26.5% 0037996 00379961 1/1   p containing nucleoside triphosphate hy 
  40::220    2e-21 30.6% 0047797 00477971 1/1   p containing nucleoside triphosphate hy 
  41::230    3e-21 38.0% 0049657 00496571 1/1   p containing nucleoside triphosphate hy 
  41::206  3.3e-21 36.8% 0047538 00475381 1/1   p containing nucleoside triphosphate hy 
  37::225    1e-20 30.6% 0049853 00498531 1/1   p containing nucleoside triphosphate hy 
  41::203  1.9e-20 34.2% 0048410 00484101 1/1   p containing nucleoside triphosphate hy 
  28::204    6e-20 28.3% 0047844 00478441 1/1   arboxykinase-like                       
  44::246  2.9e-19 31.5% 0048702 00487021 1/1   p containing nucleoside triphosphate hy 
  31::228  3.9e-19 31.4% 0040678 00406781 1/1   p containing nucleoside triphosphate hy 
   6::133  4.1e-19 31.1% 0038720 00387201 1/1   p containing nucleoside triphosphate hy 
   7::220  1.1e-18 28.9% 0040419 00404191 1/1   p containing nucleoside triphosphate hy 
  30::246  3.6e-18 28.4% 0039472 00394721 1/1   p containing nucleoside triphosphate hy 
  31::218  5.4e-18 28.7% 0043440 00434401 1/1   p containing nucleoside triphosphate hy 
  42::229  7.8e-18 32.9% 0040588 00405881 1/1   p containing nucleoside triphosphate hy 
   7::239  8.4e-18 22.6% 0044438 00444381 1/1   p containing nucleoside triphosphate hy 
  41::229    3e-17 30.4% 0053350 00533501 1/1   p containing nucleoside triphosphate hy 
  15::202  3.1e-17 28.6% 0035641 00356411 1/1   p containing nucleoside triphosphate hy 
  31::228  4.1e-17 34.3% 0039270 00392701 1/1   p containing nucleoside triphosphate hy 
  30::230  7.5e-17 31.4% 0037926 00379261 1/1   p containing nucleoside triphosphate hy 
  34::248  1.2e-16 20.3% 0048025 00480251 1/1   p containing nucleoside triphosphate hy 
  10::251  3.3e-16 26.0% 0042094 00420941 1/1   p containing nucleoside triphosphate hy 
  43::241  7.9e-16 24.7% 0051376 00513761 1/1   p containing nucleoside triphosphate hy 
  42::210  1.4e-14 30.9% 0053247 00532471 1/1   p containing nucleoside triphosphate hy 
  42::221  1.5e-14 25.6% 0049881 00498811 1/1   p containing nucleoside triphosphate hy 
  40::239  1.6e-14 24.5% 0040237 00402371 1/1   p containing nucleoside triphosphate hy 
  43::223  3.4e-14 25.4% 0048044 00480441 1/1   p containing nucleoside triphosphate hy 
  18::222  4.2e-14 23.4% 0043986 00439861 1/1   p containing nucleoside triphosphate hy 
  20::203  5.4e-14 26.9% 0047701 00477011 1/1   p containing nucleoside triphosphate hy 
  37::202  8.9e-14 31.6% 0045157 00451571 1/1   p containing nucleoside triphosphate hy 
  36::249  1.3e-13 30.0% 0047073 00470731 1/1   p containing nucleoside triphosphate hy 
   3::250  2.1e-13 27.6% 0043790 00437901 1/1   p containing nucleoside triphosphate hy 
  38::197  6.7e-13 31.4% 0050867 00508671 1/1   p containing nucleoside triphosphate hy 
  40::218  1.2e-12 31.9% 0046441 00464411 1/1   p containing nucleoside triphosphate hy 
   9::246  2.1e-12 27.8% 0038674 00386741 1/1   p containing nucleoside triphosphate hy 
  41::214  5.4e-12 32.3% 0049919 00499191 1/1   p containing nucleoside triphosphate hy 
  36::219  1.2e-11 23.6% 0051138 00511381 1/1   p containing nucleoside triphosphate hy 
  29::227  1.7e-11 27.2% 0048255 00482551 1/1   p containing nucleoside triphosphate hy 
  29::233  3.2e-11 26.4% 0051325 00513251 1/1   p containing nucleoside triphosphate hy 
  30::215  4.7e-11 30.1% 0052726 00527261 1/1   p containing nucleoside triphosphate hy 
  41::220  8.2e-11 26.7% 0048963 00489631 1/1   p containing nucleoside triphosphate hy 
  20::238  1.1e-09 22.2% 0036729 00367291 1/1   p containing nucleoside triphosphate hy 
  30::209  1.2e-09 20.3% 0041053 00410531 1/1   p containing nucleoside triphosphate hy 
  36::203  1.3e-09 34.2% 0043218 00432181 1/1   p containing nucleoside triphosphate hy 
  20::233  1.6e-09 22.5% 0041617 00416171 1/1   p containing nucleoside triphosphate hy 
   5::246  1.6e-08 25.9% 0052155 00521551 1/1   p containing nucleoside triphosphate hy 
  38::233  4.8e-08 23.7% 0047291 00472911 1/1   p containing nucleoside triphosphate hy 
  43::246  1.1e-07 25.3% 0046916 00469161 1/1   p containing nucleoside triphosphate hy 
  30::246  2.2e-07 24.5% 0043792 00437921 1/1   p containing nucleoside triphosphate hy 
  35::170  1.6e-06 30.1% 0051769 00517691 1/1   p containing nucleoside triphosphate hy 
  38::223  4.5e-06 24.6% 0049933 00499331 1/1   p containing nucleoside triphosphate hy 
  40::187  7.9e-06 29.7% 0048706 00487061 1/1   p containing nucleoside triphosphate hy 
  41::216  9.2e-06 25.9% 0048272 00482721 1/1   p containing nucleoside triphosphate hy 
  15::250  1.9e-05 23.9% 0047394 00473941 1/1   p containing nucleoside triphosphate hy 
  26::210  2.1e-05 19.5% 0041032 00410321 1/1   p containing nucleoside triphosphate hy 
   3::82   2.9e-05 33.3% 0049577 00495771 1/1   p containing nucleoside triphosphate hy 
  36::61   3.9e-05 42.3% 0053315 00533151 1/1   p containing nucleoside triphosphate hy 
  42::170  5.2e-05 26.7% 0049606 00496061 1/1   p containing nucleoside triphosphate hy 
  38::219  5.4e-05 25.0% 0043012 00430121 1/1   p containing nucleoside triphosphate hy 
  41::173  5.7e-05 34.2% 0046162 00461621 1/1   p containing nucleoside triphosphate hy 
  41::194  6.3e-05 28.6% 0047607 00476071 1/1   p containing nucleoside triphosphate hy 
  38::61     7e-05 41.7% 0047839 00478391 1/1   p containing nucleoside triphosphate hy 
  11::59   9.2e-05 31.9% 0047127 00471271 1/1   p containing nucleoside triphosphate hy 
   3::228   0.0001 22.0% 0041830 00418301 1/1   p containing nucleoside triphosphate hy 
  42::219  0.00013 27.5% 0051535 00515351 1/1   p containing nucleoside triphosphate hy 
  41::61   0.00022 38.1% 0047772 00477721 1/1   p containing nucleoside triphosphate hy 
  41::61   0.00025 42.9% 0047813 00478131 1/1   p containing nucleoside triphosphate hy 
  38::61   0.00026 41.7% 0048939 00489391 1/1   p containing nucleoside triphosphate hy 
  40::58   0.00029 42.1% 0047756 00477561 1/1   p containing nucleoside triphosphate hy 
  42::210   0.0003 25.2% 0047808 00478081 1/1   p containing nucleoside triphosphate hy 
  41::212  0.00034 25.0% 0051958 00519581 1/1   p containing nucleoside triphosphate hy 
  39::61   0.00036 43.5% 0049190 00491901 1/1   p containing nucleoside triphosphate hy 
  38::61   0.00038 41.7% 0040121 00401211 1/1   p containing nucleoside triphosphate hy 
  41::224  0.00044 21.4% 0045785 00457851 1/1   p containing nucleoside triphosphate hy 
  42::212  0.00051 19.4% 0050989 00509891 1/1   p containing nucleoside triphosphate hy 
  40::61   0.00065 40.9% 0051206 00512061 1/1   p containing nucleoside triphosphate hy 
   1::250


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MEANDQTQNIPAISFRSVRKSYKQDGQTYDVLQDVTGDIQQGAIVAVLGPSGSGKSTLLSMCNLMRTPDS
00378981   1/1  ---------lpllelenlsksy....ggvlalkdvsltvepgeivalvGpnGaGKSTllkllagllkpts
00422801   1/1  ----------llllllallllllllllldpllelenlsksy..ggrlvlalkdvsltvkpgeivalvGpn
00420701   1/1  ---------lpllelenlsksyp..gggvlalkdvsltvepgeivalvGpnGsGKSTllkllagllkpts
00390411   1/1  --------------Mknlslrygn....fralkdvslelppG.ltalvGpNGsGKStLlkalagllgpds
00379581   1/1  ----------lepllevenlsksy....ggvlalkdvsltvkpgeivalvGpnGsGKSTllkllagllkp
00509431   1/1  ------------Mlelknlslsnfr......vlkdelvslefepg.ltaivGpNGsGKStlldalagllg
00490801   1/1  ------------llllllllalllelleeeeellllllalllllgdpllelenlsksy....ggvpalkd
00510251   1/1  ----------lllllllllaeellelleeeelllllllllllllgdpllelenlsksy....ggvpalkd
00440861   1/1  Mpllslge..pllelenlsksy....ggvvalkdislsipkGeildlldellellkeldgsllnvalvGp
00482201   1/1  -------------------llllelknlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllag
00367901   1/1  ------------lelknlslsy...g..ksilkdvsleip.geltalvGpnGsGKStllkalagllgpdv
00458601   1/1  ----------lllevenlsksygg....vlalkdvsltikpgeivalvGpnGsGKSTllkllagllkpts
00425571   1/1  ------------lelenlsksy....ggvlalkdvsltvepgeivalvGpnGaGKSTllkllagllkpts
00482261   1/1  -------------------lllevenlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagl
00361211   1/1  ---plellgepllelenlsksyg....gitalddvslgirkGeivllvGpsGsGKStllrnllagllapt
00404101   1/1  -------------elenlsksy....ggvlalkdvsltvepgeivalvGpnGaGKSTllkllagll.pts
00475991   1/1  -------------------lllaaelpelgelllevvnlsksyggvlalkdvsltikpgeivalvGpnGs
00530591   1/1  ------------llllllaleelpllgelllevknlsksyg....gvlalkdvsltikpgeivalvGpnG
00500441   1/1  -------------------lllelllelknlsksyggvlalddvsltikpgeivalvGpnGaGKSTllkl
00502741   1/1  -------------------lllevenlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagl
00436071   1/1  ----------pllelenlsksygg.....lalkdvsltvepgeivalvGpnGaGKsTllkllagllkpts
00475891   1/1  -------------------lllelllevknlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkl
00485451   1/1  ----------------------skiygd..ealkdvsleikkllnlsgkpgeiigivGpsGsGKsTllrl
00468691   1/1  ---------lsvpvglallgrvldvlgepidglgplllllllpivrlappllelenlsksy....gtgia
00466931   1/1  ------------------------------Mkllslslgnfralkdvslelp.geltalvGpNGsGKStL
00466971   1/1  -------------------llalllevknlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkll
00372301   1/1  yvlPllsdgmpllelenlrkpy....ggllvlndvsl...pgeivaltGpnGaGKSTllrllaglllpas
00424961   1/1  ----------lgepldglgplrpapgllelenvsksy....gtgialidlslpigkGervalvGpsGaGK
00469451   1/1  ----------allelenlskiy..ggvp.kalddvslgiepGeivalvGpsGsGKstllrllagllaglp
00436511   1/1  -----------ievpvglallgrvldllgepidgkgplelgepllevenlsksyggrklvlepletgial
00496111   1/1  --------------elenltklytg....ikaLddllslgippGeivllvGpsGsGKTtlalrllagllk
00498251   1/1  ---------vekllglalllieklflkvlprllsllelenlskiytg....ipal.dvslglgGlppGei
00495371   1/1  ------------------------------esalellleledltklstgikaLddvlggglpkGeivlll
00488521   1/1  -----------lllllalelllevenlrist....gikeldkllsgglppgeitlivGpsGsGKTtLllq
00367481   1/1  -----------yvrPelldepllelengrhPllsksyg....gkvvlndislsip.gellvitGPngsGK
00379601   1/1  ------------llllpllllpdeplaaldvalqralvslerllellvdpgasdihinpggpvrvridgv
00457311   1/1  ---------------------------------------mkkgeiigivGpsGsGKSTlarllagllekp
00503371   1/1  ------------------------------Mmlkslelknfkslkdvsligdfspg.ltaivGpNGsGKS
00500611   1/1  ----------pgllsllelllelenltklptg....ipaLddvlgggipkGeivllvGpsGsGKTtlllq
00422141   1/1  ------------dlsleelekllelllrdllglgplvklldplleeavvngasdihiepgggllrvryri
00371631   1/1  -----------mseliiylelselewallradvgltlteaelkrlkglndlleledlskiygplsrlikl
00468601   1/1  ---------------------------------dlslevkkgevialvGpnGvGKTTllakLagllapqg
00448931   1/1  -------------------------------LddvslsvepgevialvGpnGsGKTTllnalagllapdg
00414121   1/1  ---------------------------------------kpgevvllvGpsGaGKTTLlrallglleglk
00495031   1/1  lsalellleledltkistg.........ipaLddvlsggipkGelvllvGpsGsGKTtlllqlagllalg
00485931   1/1  ------------------------------------LsvpkgevvalvGpnGaGKTTllallagllaptg
00532531   1/1  ----------------------------vlalkdvslviekGevvallGlSGsGKTTLlrllagllipdd
00464791   1/1  ---------lsvpvgdkllGrvldvlgepidglgpllalerlpierlappllelenlskrfgtgi....v
00475371   1/1  ------------------------------alddvslsikkgevialvGkgGvGKTTlaanlagllaptg
00381441   1/1  -----------------------------------------GeliaivGpsGsGKsTLlklLagllppds
00437981   1/1  --------lveklrpknldkvigqee....alkdlslalkpgeiphalllvGppGsGKttlaralagllg
00426051   1/1  ---------------------------------------kpgevialvGpsGsGKSTlakllakelglef
00437941   1/1  -----lrplveklrpknlddvygqe....evlkalslalekgrpehlllvGppGtGKTtlakalaglllp
00368501   1/1  ------kerllllelrnvllddviGqe....eakealsealelplkrpelfdglgvelpgknvlLvGppG
00462761   1/1  -------------------------yygdvtaldgvsltikkgevialvGpsGsGKsTlaraLagllpee
00503741   1/1  --------------fifldlrplallplpdrlvgrdeeiealskalgg......aldgvslsiepggivl
00480471   1/1  -----------------------------------sleikkgekvaivGpsGsGKSTLlnaLagllspts
00489571   1/1  ---------------rvknlsksyggk....talddvslsvepG.ivgLlGpNGaGKSTllrllaGllkp
00512891   1/1  ------------------------------------------evilltGppGvGKTTlakalagelgakf
00478411   1/1  ---------------------------Ggvlalhgvsldve.gevvlltGpsGsGKStllralagl....
00493431   1/1  ----------------------------------------kGelivllGpsGaGKsTllkllagllgpts
00475521   1/1  ----------------------------evlalhgvsldve.gevvllvGpsGsGKStllralag.....
00368571   1/1  --------------------------------------------llgvrllpplppklagllplagladg
00510561   1/1  ------------------------------------ldglgepldgllpilaklfrpievlalgllerks
00515531   1/1  ----------------------------------------kgekvallGlsgsGKSTllnrllglefayg
00468951   1/1  ------------------------------------lnvlgesidalgkilseilkllekgfltalglle
00490731   1/1  ---------------------------------dvslsvkkgkvialvGkgGvGKTTlaaklagllakrg
00515511   1/1  ----------------------------------------kgekvlllGlsgsGKSTllnrllgleflpg
00379961   1/1  ----------------yrpvdfddivGqeealralslalaagppegvllvGppGtGKstlaralagllpp
00477971   1/1  ---------------------------------------hkgelvvlvGPsGaGKsTLlnaLlgll.pts
00496571   1/1  ----------------------------------------GkgelivllGpsGsGKsTlarlLagll...
00475381   1/1  ----------------------------------------mkgeiialtGpsGsGKsTlarlLagllkpt
00498531   1/1  ------------------------------------ldklgkildlalkileksflklevlalgvlerke
00484101   1/1  ----------------------------------------kgpvigivGpsGsGKTTllraLagllkprg
00478441   1/1  ---------------------------aevlalhgvsldin.gegvlivGpsGsGKStlalaLagl....
00487021   1/1  -------------------------------------------rmkiivltGpsGsGKsTlarlLaell.
00406781   1/1  ------------------------------llkdlslgippgknvllvGppGtGKTtlakalagelgvpf
00387201   1/1  -----mssgepllevenlskry....ggklalkdvslsvekgeivlLlGpnGaGKTtLlralagllgpts
00404191   1/1  ------vellpkvtlddlvgleelkealkealellslgikpgeivllyGppGtGKTtlakalanelkkrg
00394721   1/1  -----------------------------ealeallealrrgpprnvlLvGppGvGKTtlakalakelaa
00434401   1/1  ------------------------------alddvslsvkkgliigitGpsGsGKTTlaraLaellrerg
00405881   1/1  -----------------------------------------gervglvGrpgaGKSTLlnaltglkaivs
00444381   1/1  ------asdelekllelrpvlledvigqeeakkalslalelplkrlelfgklddligrspairrllellg
00533501   1/1  ----------------------------------------rgeiialtGpsGsGKsTlaklLaellphld
00356411   1/1  --------------lknlsksyg....ilkalkdislelkkgikilllGlsgsGKSTllnrllgleygpT
00392701   1/1  ------------------------------aledlslgirpgknvlLvGppGvGKTtlaralagllgapf
00379261   1/1  -----------------------------drllleelrpvllddviGqeeakealsealrlplkrlelfe
00480251   1/1  ---------------------------------EdlslavgkgkvialvGkgGvGKTTtaakLaaalaer
00420941   1/1  ---------lrpvllddvigqeeakeallealalplkrldlglslgirpgkgvllyGppGtGKTtlakal
00513761   1/1  ------------------------------------------kiiaivGkgGsGKTTllnklaglla.dg
00532471   1/1  -----------------------------------------pGkiIvitGpsGsGKsTlarlLaellngl
00498811   1/1  -----------------------------------------kPgkiigltGpsGsGKsTlarlLae.l..
00402371   1/1  ---------------------------------------rpgrnvllvGppGvGKTtlaralagllvrss
00480441   1/1  ------------------------------------------rlivllGpsGaGKsTlakl..Laellpg
00439861   1/1  -----------------kleeveristgipeldellgGglpkgslilitGppGsGKTtlalqlaanlakn
00477011   1/1  -------------------eelrklldlidklrdlllsldlglpkvaivGrsgsGKSTLlnallGldvlp
00451571   1/1  ------------------------------------MsikkgeiiaivGppGsGKsTlaklLakll....
00470731   1/1  -----------------------------------arpltfddvvgqdeakeeleellagllgikkpkvi
00437901   1/1  --slllvekyrpvllddvvgqeeakeallealalararplkrpelflslgirpgrillLyGppGvGKTtl
00508671   1/1  -------------------------------------hvsllklgeldislsikkgevivlvGpsGsGKs
00464411   1/1  ---------------------------------------vkkgeiivllGpsGsGKsTlaklLagllgpt
00386741   1/1  --------klrpvllddvvgqeeakeallealkavllgirpgehllLvGppGtGKTtlaralagelga..
00499191   1/1  ----------------------------------------kgkiigitGpsGsGKsTlaklLaellgatv
00511381   1/1  -----------------------------------llllkpgglvlitGPtgsGKsttLlralnrleeag
00482551   1/1  ----------------------------everlstgipalDellgGglppgslvliaGppGsGKTtlalq
00513251   1/1  ----------------------------iellsdlslsipspevvllvGppGsGKstlakklaell....
00527261   1/1  -----------------------------npfilgpkvdledfigreeelkeleeal..pkivlltGprG
00489631   1/1  ----------------------------------------MkgklillvGppGsGKtTlaraLaellglp
00367291   1/1  -------------------vtlddvvgqeeakeallealelalkgldlflslglrpgrnvllyGppGtGK
00410531   1/1  -----------------------------gelknlslelkkglkillvGlngvGKTtllkrlaggefv..
00432181   1/1  -----------------------------------slelkkglkvalvGrpgvGKStLlnallglkvaiv
00416171   1/1  -------------------diigqeeakkallealslaartgenvllvGppGtGKttlaralakllpr..
00521551   1/1  ----plveklrpvllddvigqeeakeallealarlkapelflslglrpgkgvlLvGppGtGKTtlarala
00472911   1/1  -------------------------------------mkmkkgklilltGppGsGKtTlaraLaellgap
00469161   1/1  ------------------------------------------llIvieGppGsGKsTlaklLaerlgltg
00437921   1/1  -----------------------------lglllveklrpkllddvvgqeealerlllalkagklphlll
00517691   1/1  ----------------------------------lsfelkpglnvgivGhvgaGKSTLlnallgllgaiv
00499331   1/1  -------------------------------------PslslkkgklivltGppGsGKtTlaka..Laer
00487061   1/1  ---------------------------------------ldMkkgklIvieGppGsGKtTlakaLaer.g
00482721   1/1  ----------------------------------------kgkiigltGpsGsGKsTlarlLae.lglpv
00473941   1/1  --------------eklrpvllddvvgqeevkkalllalalallrgepgehvlLvGppGtGKTtlarala
00410321   1/1  -------------------------yggllllkdlslelkkglkilllGlngaGKTTllnrllggefp..
00495771   1/1  --nellrpivanvdlvlivvdardplfslnlllrylvlaeaagippvlvlnKiDlleeeedlelleellk
00533151   1/1  -----------------------------------MsldikkgklivltGppGsGKtTlar---------
00496061   1/1  -----------------------------------------gklivltGppGsGKtTlakl..Laerl..
00430121   1/1  -------------------------------------girpggnvllvGPpGvGKTtlakalagllfp..
00461621   1/1  ----------------------------------------mkgmiialtGppGsGKsTlaklLaerlglp
00476071   1/1  ----------------------------------------kgkiigltGpsGsGKsTlaklLaelglpvi
00478391   1/1  -------------------------------------msikkgklilltGppGsGKtTlar---------
00471271   1/1  ----------praileleslikslle..kllellkrlslklkkglkvalvGrpgvGKSt-----------
00418301   1/1  --drplleklrpvllddv...iGqeeakkallealalplkrlelfeklrgirpgknvlLvGppGtGKTtl
00515351   1/1  -----------------------------------------mngklivltGppGsGKtTlara..Laerl
00477721   1/1  ----------------------------------------kpklilltGppGsGKttlara---------
00478131   1/1  ----------------------------------------kgkvivltGppGsGKtTlarl---------
00489391   1/1  -------------------------------------lsikkgklivltGppGsGKtTlak---------
00477561   1/1  ---------------------------------------kkpkvillvGppGsGKtTl------------
00478081   1/1  -----------------------------------------gkvivltGppGsGKtTlarlLaellkplg
00519581   1/1  ----------------------------------------kpkvilltGppGvGKttlarlLakll...g
00491901   1/1  --------------------------------------lmkgkiilltGppGsGKttlaka---------
00401211   1/1  -------------------------------------elkrglnvgivGhvgaGKSTLlna---------
00457851   1/1  ----------------------------------------PkgklivltGppGsGKtTlakaLaerlglp
00509891   1/1  -----------------------------------------pkvigitGpsGsGKTTlanaLarllkarg
00512061   1/1  ---------------------------------------kkkkgklivltGppGsGKtTla---------


                         -         -         *         -         -         -         -:140
query           GEVNIYGKEVREWNVNELRRTAALAFQSAPVLDGTVRDNLSLVQRLHQSQLYSPEKLASLAGLPPELLDR
00378981   1/1  Geilldgldllllslaelllllrrgigyvfqdpalfpgltvrenlalglllaglskaeaaaraaellell
00422801   1/1  GsGKSTllkllagllkptsGeilldgldilalslaelrrrigyvfqdpalfpltvrenlalglllallll
00420701   1/1  Geilldgldllllslaellalrrgigyvfqdpalfpgltvrenlalglllaglskaeararalellellg
00390411   1/1  glrvgklsdlirrgadkasvelvfeldggllallrllslsggeklrvalakallgnpeillngepvnhld
00379581   1/1  tsGeilldglditalslaelrrrgigyvfqdpalfpgltvrenlalglllllllllllllllllalskae
00509431   1/1  grslrllragglsdliflgslirsgadrasvelvfdlsdglyllerselilrrlilkpgsgeilingkdi
00490801   1/1  vsltikpGeivalvGpnGsGKSTLlkllagllkptsGeilidgkditglspqelrrlgglvlqdvllffl
00510251   1/1  vsltikpGeivalvGpnGsGKSTLlkllagllkptsGeilidgkditglspqelrrlgglvlqdvllffl
00440861   1/1  sGsGKStLlnaLlgllkpdegvilvggkgvTrdivlytledgvkltliDtpGlgdtklsdeeklilkyle
00482201   1/1  llkptsGeilldgkdilglslkelrgigyvvqqdallpsltvlenlllgllllgllllllaakeaalral
00367901   1/1  sallrlsglidlilkgllllprstvatvelifdllgllliirrlilrdgsgeilidgkdislldlrelrr
00458601   1/1  Geilldgkditglspqelrrlggvvvqevllffltllenlllglallllllvlllllllllllllaakea
00425571   1/1  Geilldgldllalsl..lrrrigyvfqdpalfpgltvrenlalgllllglskaeaaaralellellgldd
00482261   1/1  lkptsGeilldgkdildlslaelrgigyvfqqdallpsltvlenlllgllllgellllllaakeaalral
00361211   1/1  ggsvlldgleisalslaerlragigyvfqdlalfpeltvlenlalg.........rarellerlglail.
00404101   1/1  Geilldgldltalslaelrrgigyvfqdpalfpgltvrenlalgllkaeararalellell.gld.elld
00475991   1/1  GKSTllkllagllkptsGeilldgkdildlslaelrgigyvfqqdallpsltvlenlllglllagellll
00530591   1/1  sGKSTllkllagllkptsGeilldgkditdlslkelrgigyvvqqdallpsltvlenlllgllllgllll
00500441   1/1  lagllkptsGeilldgkdildlsl..lrrgigyvfqdpalfpgltvlenlllgllllglslaeaaerale
00502741   1/1  lkptsGeilldgkdilglslaelrgigyvfqqlallpsltvlenlalgllllglskaeaaaraaellell
00436071   1/1  geilldgldlla.....lrrgigyvfqdpalfpgltvlenlalgllllgllealaralellellglgdld
00475891   1/1  lagllkptsGeilldgkdilglsllellrrgigyvfqdpalfpgltvlenlllgllllglalkeaalral
00485451   1/1  Lagllkpllltggkvlvigldifrlsarelrkrig.vfqdpallphltvpenldlglll..eilervlel
00468691   1/1  lidvsltigrGervglvGpnGaGKttLlkllagllkpdsgeilvdGedlr..elrelrrrigyvfqdpal
00466931   1/1  lkalagllgpdsGeilldgkdilalspeellrllrrrigyvfqepalfpgltveenlllglllrlllell
00466971   1/1  agllkptsGeilldgkdilglslaelllllrrgigyvfqdpalfpgltvlenlllgllllglllllaake
00372301   1/1  ggilvdgedlr..........igyvfq.............................llervgled.lldr
00424961   1/1  ttLlrliaglldpdsgeilldgvdigersrevtelleelrrviglvfqdpplfprltvaenialgaeyfr
00469451   1/1  tsGeillldgkdvlylsleesleqlrrrigyvfqdpalfp....................aeellelvgl
00436511   1/1  ddvsltikkGervglvGpsGaGKtTLlkllagllkpdsGeilvdgligerlrevlelirelelaelrrri
00496111   1/1  ptggkvliiglelsaeelrerrrrigyvfqepalfpeltvlenlalgll.....................
00498251   1/1  vlllGpsGsGKTtLalrllagllkpgggvvyidgeesldll...rarrlgvvlqelllfpeltveenl..
00495371   1/1  GpsGsGKttlalrllagllkp...evlvdgldltglspa..rggiglvfqteallppltvrenlealgld
00488521   1/1  lavngllppdsGei...............ggkvlyvdqeeslfpltvlenlalg.......gedveelle
00367481   1/1  STllralaglllpasggilvpgedalll.......................................rvd
00379601   1/1  lelllvvldllsldleellalasriavlagrdiserrlpldgallpdgsrvrvrlsplptllggeslvir
00457311   1/1  gsgvividgddlyklsreelrklrrrigmvfqdpalflnpgltvrenlaeplrllklgkk....llepvg
00503371   1/1  tlldaiagllgpdsgeirldgkdlliylsdlirrgagiayveqefdlfdgltvlenvllglgdeliirrr
00500611   1/1  lagllapdsgeillggkvlyislee..slrrrrigmvfqelgldpdltv............arerviell
00422141   1/1  dgvlielifldeeellallsrlkslaglpilearlpqggriqavlppvvvdfrvstlpdigglslvirkl
00371631   1/1  lleellrllgklalddvslsvkkpeiigiaGpsGsGKSTlarlLagllapesgglkvlligtDifylpa.
00468601   1/1  gkvlllgaDiyraaaae.rlgigavpqdvplfpsltvldnlalardlleaakaagydvvlidtaglld..
00448931   1/1  gkvllvgadiarla...areqlgivfqd...pgltvlenlalg.....eleararellellgled.ydvv
00414121   1/1  vaviepdfgeilidgqlledlgvlavrlgigyvpqtlglfpaltvlellalall................
00495031   1/1  lgliplggkvlyiglelt.lsperlrlraqsl...................gldldellerllvidllel
00485931   1/1  gkvllvgadi.........rrigavpqlpvlfprltvlenlalggadlaeraeellellglegfdvvliD
00532531   1/1  geilidggdinleggfyakaigllrrkigyvfq..lfpfltvlenvalgld.glvdeedleraenllalv
00464791   1/1  lidvslpigkGervglvGpnGaGKTtLlkllagllkpdsgeivvygligerprevrellglllelgvlf.
00475371   1/1  gkvlligaDirrpsarellgllgell....................................gldvlvga
00381441   1/1  gsigslttrlprlgevdgvdltfls....reeigyvfqepallpdltvlenlylglllalllaleegkiv
00437981   1/1  pdsgkilldgkdi........rrgiglvfqliglfphltvlelvalgl.ggilveevrellkel......
00426051   1/1  idsgdilrdgvdlggesglllrdlrrliglvfqdpilfpgltvglllffldnidlgllirgdeeleaale
00437941   1/1  tsg.....gvrvlgidaselld................................................
00368501   1/1  vGKTtlaralakllgapfiridgseltekdyvGesvearlrelfeeaigyvfqdpalfpgtvlenl..al
00462761   1/1  pgsgvvlldgddlr......lglliglvfqdpdllpfltvlenvllpllaagliv.ivdgtlllvglrea
00503741   1/1  lvGppGvGKTtLakllagllkpkfgeillfg..................................kvvyv
00480471   1/1  vpettrdfilgeilldgkdltlvdtpgiargrlklllearraaigivfqdvdllltltvaenlllgldll
00489571   1/1  t.....................................................................
00512891   1/1  gsvsltgrdv.....rsarrgigyvfq.......tveellgllaelvgle.........vrgeleellkt
00478411   1/1  .Gtilldg.dlvrlglkd...gigmvfqdpalfplltvrengvalglllaglskaeieervdlllelvgl
00493431   1/1  gvisv.ggttreprpgevrgigyvfqsgalfphlivagnllegaevhgllygtskerv.eealekgllvl
00475521   1/1  sGeilvdgdlv...dleplrrdigmvfqdpalfplltvrenvilgllelaglskaealarvdellelvgl
00368571   1/1  dglgvllGklldgvpvtldlgelgrhllivGptGsGKStllrllaglllpdggrviviDpkgeyaglarg
00510561   1/1  verlstGikaLDlllgiGglprGelvliaGppGsGKTtlalqlaanlaaqggkvlyisteesleql..ra
00515531   1/1  pTigptsgtieidgvklqlwDtgGqerfrslwilyfedadaiifvvdlsdrdsflelrrwigrlfqdlnl
00468951   1/1  rksverlstgikaLDlllgiGglprGelvlivGppGsGKTtlalqlaanlaklggkvlyidteesldqlr
00490731   1/1  gkvllidaDpyrpaadellgvlaee...................................lgldvl.lga
00515511   1/1  pTigptegtieidgvklqlwDtgGqerfrslwllyfegadaiifvvdlsdgdsllalrrwigrlfqslnl
00379961   1/1  dsgrivlvgnlsdlldpkdlrellragiplvflnfaalpasllesel.......................
00477971   1/1  gvisvsgttr.pprpgevdgvgyvfqsrelfpeltvagnflegaevr..gnlygtsrerveelleagldv
00496571   1/1  ggsvldtgepirgeplgelir..glvfqdpllldeltvlenlalgrylhl.....glilaalaagvgvvl
00475381   1/1  sgivsvdglrlavlsrdllgllreglir.igyvfqdyalfprltvlenvllgll................
00498531   1/1  verlstGikaLDallgiGglprGsltliaGppGsGKTtlalqlaanlaklggkvlyisteesleql..ra
00484101   1/1  grvavigldigrldldellgigylfqdvgllpvltvrenlalllrglpgysaeeleralellelagfdvi
00478441   1/1  .Gailvdd.dlvll..elrgrdilmvfqppalfpllevrglniaevlelaglskaealkrvdlvlelvgl
00487021   1/1  ...gvvvidtddllra.........gevfqdyalfphltvlelldnvllgleirgllkaerlervevlle
00406781   1/1  vrisa...........................................................sellgk
00387201   1/1  fvvsptftlvreyelGeilldgrdlyrlsleeallllfldeileidglllvelregigyvfqd-------
00404191   1/1  grvlyvsa............................................................de
00394721   1/1  gsgpilldgvpvvrldlsellsv...............................................
00434401   1/1  gsvavidlddfyrpaaell....lreglgidfqlpdaldrellreevlellgl...........gevviv
00405881   1/1  gypgttldpnlgvvelddgrqlvlvDtpGlielaslgeglvrqalealeradvillvvdasd........
00444381   1/1  arpgenvlLvGppGtGKTtlakalakllgvpfirid..................................
00533501   1/1  tgdvlldgepigtp....lgrgigyvfqdpalfpgltvrenlelllvfadrygvlrglikpalaegvsvi
00356411   1/1  iginegtieidgvkltlwDtgGqesfrklwilyfegadaiifvvdasdrdsflnldkwrnrlgevlqlle
00392701   1/1  grvda...........................................................sdllgk
00379261   1/1  rlglrrpgknvlLvGppGvGKTtlaralAkllgapfvevdaselteggyvgedlekrirelfqearl...
00480251   1/1  gkkvllidlDpyrpsapeqlgilgellgvpvvgvltgldlagalrealell.............llegyd
00420941   1/1  agelgapfiridg.........................................................
00513761   1/1  gkvlvidlDparanlpeqlgidirdlidletvmelglgpngalvfaleellt.tldillealelleedyd
00532471   1/1  ggivsvddlgrdvgelggaalldivde.grliglvfqdldllpllevlellaarleellerippa.....
00498811   1/1  ..gvividgddltrelvaggglliglifqdfgl.felldrellielllenlalglalegvildalrrrll
00402371   1/1  gpilldgvpfvrldaselle...............................................fgk
00480441   1/1  livisvgdttrepregevlgvdyvfvdrelfeelivagnlledaivhgllygtskerieealda.glg.v
00439861   1/1  ggkvlyisleesreqlleraerlgldleellllgll..............................sili
00477011   1/1  vgggpgtrrptelrlsetpgltvlvvflelgerldllglvfqdfsllpelielenralagpiagisrdai
00451571   1/1  glivldgddl.......lreaiglvtqdgelllelidegilvpdeiviellrealeeldadgvildgfpr
00470731   1/1  llvGppGsGKTTlaralakel..gagfilidgddlrekavgeleklgrdlfqvare.gglvpdilfidei
00437901   1/1  akalakel..........gapvieidaselrd......................................
00508671   1/1  TlaraLakrLeepgsgvvlldgddlraglsiglilsdedraalrrrlgevfqelllagrlvvldgtalgl
00464411   1/1  ggsvlltgepvsgeplge...ligevfqdgilfpdltvlenv....algrygll.glikealaegvivil
00386741   1/1  .................................................................pfvrl
00499191   1/1  gdvd..............gllvgvvfqddfylllpalevlengaflldlllpdaldrelllelllalveg
00511381   1/1  kgvilvkdaidtrlgielvvsriglvleavglffaldllelll...........................
00482551   1/1  laanaalplelgklggkvlyisteeafsperlreralslgldleelldrllvidat..............
00513251   1/1  gfilidaddlr...........................................................
00527261   1/1  sGKTtllkalakel..gkpviyidlselsskgyvdleellrela.................eelgellel
00489631   1/1  f..iridgddllrellgellgrgigfgfqqgdlledatvlenlalllldeidka................
00367291   1/1  Ttlaralanel..........gapfirvda........................................
00410531   1/1  dygptigvnfktvevdgvkl..................................................
00432181   1/1  sdypgttrdptlgvveldgrkl.............................................vli
00416171   1/1  .....sgvpfvrvncsalte........................................dlleselfgh
00521551   1/1  gllgapfvrlsas.........................................................
00472911   1/1  fisgddl......lrglageggkpl.............................................
00469161   1/1  lsvlltredgfgtplgelirelllegfqdlilvpdllvlellaanraglrelikellaagkgvildrfpl
00437921   1/1  vGppGvGKTtlaralarlllgsgggvdvieldasdlrgvddlreligevlqalglllgg...........
00517691   1/1  gdvlvdg...........................................gtlllllgllsfllalvlds
00499331   1/1  l..glpfidtddllrepvigagtdigevfqdlllaggllvddev..rrlllealdell....laggkvvi
00487061   1/1  argldvvviyepvdywaavgggdllrlirelllrlgfgepdafdnellgellealleg............
00482721   1/1  idtddlyrelvaggtplgerirellgegyllpdea......lfrallaellfgdllalalldgvvydrlr
00473941   1/1  gllga.......................................................pfielsasdl
00410321   1/1  eygptiginvgtveldgvklq.................................................
00495771   1/1  elesigvdvvlv----------------------------------------------------------
00533151   1/1  ----------------------------------------------------------------------
00496061   1/1  glpvistddllreevepggtdlgeifqalllagel..lfddevlgllrerldelielllagg..vvildg
00430121   1/1  .....sgvpfirinlselte........................................kllvseligh
00461621   1/1  f.istddly......revvergtelgklikdyfd.pgalvpd.llirlllerllfldeg...ggflldgf
00476071   1/1  dtddltregvll...ggpllerirellgegyllfdeal................drellaallfglel.e
00478391   1/1  ----------------------------------------------------------------------
00471271   1/1  ----------------------------------------------------------------------
00418301   1/1  aralakll..........grpfirvdaselteaelvGyesgarlrelf......................
00515351   1/1  ..glpvistddllreavpg.gtdigelfqdyllfpfltvdeni.......rglllealeellaag.kvvi
00477721   1/1  ----------------------------------------------------------------------
00478131   1/1  ----------------------------------------------------------------------
00489391   1/1  ----------------------------------------------------------------------
00477561   1/1  ----------------------------------------------------------------------
00478081   1/1  ggvvvidt........................................ddlrreairelllgldlleilf
00519581   1/1  lpliidldalaellfgdvgglvvdli............................................
00491901   1/1  ----------------------------------------------------------------------
00401211   1/1  ----------------------------------------------------------------------
00457851   1/1  vistddllreavpggtrlgeviqdlfllggllffdeldel.........................lkeri
00509891   1/1  lkvavidrdpgrld...............................ldeplgvdrerlrrvgelalllagg
00512061   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           SARDLSGGQRQRLSLARTLSNPSSILLLDEITSALDPVSALEIEELIKRQHQEKKWTVMWVTHNMEQAKR
00378981   1/1  gldd.lldrlvgeLSgGqrqrvalarallldpdllllDEptsgLDpetraellellrelakelgltvllv
00422801   1/1  glskaeararalellellplgldt.lldrlvgeLSgGqrqrvalArallldpdllllDEptsgLDpetra
00420701   1/1  ldd.lldrlvgeLSgGqrqrvalarallldpdllllDEptsgLDpetraellellrelakelgltvllvt
00390411   1/1  lrelllnllrrrgiglvpqehdlfplltvaenialldelaglpkygnylsllkeklkelnallkelelql
00379581   1/1  arervlellelvgldt.lldrlvgeLSgGqrqrvalarallldpdllllDEptsgLDpetraellellre
00509431   1/1  slldlrelrrligyvpqdpnllfqltvlenlllgpeerrelldellglellsleealaraeealeelnal
00490801   1/1  tll......lllaakeaalralllllllgletlldrrpseLSgGqrqRvalArallldpdlllLDEPtsg
00510251   1/1  tll......lllaakeaalraellllllgletlldrrpseLSgGqrqRvalArallldpdllllDEPtsg
00440861   1/1  eadlvllviddglteldlellkllkelgkpvilvlnkiDllkkeelekllkslnkelglkelrrgigyvf
00482201   1/1  llllllgletlldrlpseLSgGqrqrvalArallldpkllllDEPtsgLDpetraellellrelak..gl
00367901   1/1  ligyvpqdpalfpqltvlenlllglelrrklldellgllellalleellklleellkelevleaalaall
00458601   1/1  alralllllllgledlldrlpseLSgGqrqrvalArallldpdllllDEPtsgLDpetraellellrela
00425571   1/1  .lldrlvgeLSgGqrqrvalarallldpdllllDEptsgLDpetraellellrelakelgltvllvthdl
00482261   1/1  llllllgletlldrlpseLSgGqrqrvalArallldpdllllDEPtsgLDpetraellellrelak..gl
00361211   1/1  .drlpgeLSgGqqqrvaiaralaldpdllllDeptsalssrssendpetvaellellkelakelgvtvil
00404101   1/1  rlvgeLSgGqrqrvalarallllleelsldpdllllDEPtsglDpetraellellrelake.gltvllvt
00475991   1/1  llaakeaalralllllllgletlldrlpseLSgGqrqrvalArallldpdllllDEPtsgLDpetraell
00530591   1/1  llaakeaalralllllllgletlldrlpseLSgGqrqrvalArallldpkllllDEPtsgLDpetraell
00500441   1/1  lllllgl.edlldrlvseLSgGqrqrvalarallldpdllllDEPtsgLDpetraellellrelakelgl
00502741   1/1  gledlldrlpseLSgGqrqrvalArallldpdllllDEPtsgLDpetraellellrelake.gltvllvt
00436071   1/1  rlvseLSgGqrqrvalarallldpdllllDEptsglDpetralllellrelaeelgltvllvthdldlal
00475891   1/1  llllllgletlldrlvseLSgGqrqrvalarallldpkllllDEPtsgLDpetraellellrelake.gl
00485451   1/1  lelvgldvvlldtyphelSgGqrqRvaiaralaldpdvlllDEptsglDpetralelldllrtdldkelg
00468691   1/1  fpeltvlenlalgallag............lgl.aeyldelgkdLSgGqrqrvalAr.....pvlLllDE
00466931   1/1  lgrlelllllllllellallldlllllllllllllllllllvlllllllllvlllllllalllllalkea
00466971   1/1  aalrlellllllgletlldrlvseLSgGqrqrvalarallldpdllllDEPtsgLDpetraellellrel
00372301   1/1  lpstlsgGqrqrvai.ralatepsllLlDEptsgldpelraalaeallellaelgatvlfvtHdlelaal
00424961   1/1  degadvllladsllrlagalrevlgrlgrelSgGqkqrvaiarallleragnleggGsiTalatvlvegg
00469451   1/1  e.dlldrlpgelSgGqrq..aiara.ardpdllllDeptsalrgsenDpetraeilrlLkelakelgvtv
00436511   1/1  gyvfqdpalpallrllalfpaltvaenlrfglglavlllldsatrlaqakreisalarellervglpgdl
00496111   1/1  ..drlpgeldlSgglqrqrvaia...agdpdllllDeptsalrslgndpelraellrllkrl.kelgvtv
00498251   1/1  ..........................drlprllsggqrqrvvidsalalrpkllllDEPtsgldplsare
00495371   1/1  lrglldrerviellelvglee.lldrlprelsggnqrqrvvia.alallpkllllDEptsaldvslraei
00488521   1/1  rlgl..dlldrlphqlsggqrqrvaiaralaeelkpdllvlDeitalfraelegrptsaldvsllrellr
00367481   1/1  eiltrvglsdl.ldrgls.lsggerqrvalaralatdpslllLDEptsgldpedgaalaeallellaell
00379601   1/1  klpkliltledllelenlsfsy...gg.kealkdlslaiepgelvlivGptGsGKTTllkallgllppde
00457311   1/1  lp.evldryphelsgGqrQRv...ralaldpdllilDeptsalgqpdpelr.elldllifldadlgltli
00503371   1/1  ilrdgrseyllnglgvslkeliellldlsggelnrvalllqgevdlllldepterldfldelagleeykg
00500611   1/1  elvgl.lelldrlprelkrsggqrqrvviDaralllrpel..lDEptsaldvslraeilrlLkrlakelg
00422141   1/1  reviltledlglsy....gdpealkdlslaippgglvlltGptGsGKtTllralagllnpdegriltied
00371631   1/1  eqlkrigllfqkglpealdveellellldlke.................gledilvpvlsggqkqrlala
00468601   1/1  ldrlvgelsggqkqrvaiarala.apevllldeptsgldalae..llelleel....gltvlvvtKlDgt
00448931   1/1  liDtagrlrlpselsggqkqrvaiaralaaplppevllldeptsglda..lrellellrel....gltvl
00414121   1/1  .......lredpdlilidsgGqkqrlalaralladpdlgellllDeptlvlDaasgedlldllkelaeql
00495031   1/1  vgl.lelldrlprelsggqrqrvviDalalllrpell..DeptsaldvqlvaeilrlLkrlakelgvtvi
00485931   1/1  tagrgrrvgelsggqkqrvaiarallllldpelllldEptsglda......lrlllellkelgltvlvvt
00532531   1/1  gl.eeipnrypselsgGqqqrv...........illldEPtsgLdpvsr.....................
00464791   1/1  .......................aaellervglvaatadeppgelsggqrqrlaiAraladdqgkpvlll
00475371   1/1  rggdlsgglrqr..larallgdpdvlliDepgrgldpellallaelldllrelradlgllvvdathdlda
00381441   1/1  ildgdreraeellellgldadlviilpasleellerldrrggelsggqkqR-------------------
00437981   1/1  ........lsgGqkqrvaiaralagdpkvlllDEpt.aldpdaqnaLlklleelak..gvtvilathdls
00426051   1/1  laglprvielllegldtlaggggvvlsGgqrqrvalar....pdlllfldeptselleRllkrltrpgld
00437941   1/1  ...pselsggerqrvliaralladpkvlllDEi.daldpeaqnaLlklleelpk..gvtvilttnrleel
00368501   1/1  gllvseligappgyvggdlggllteavlealriklvegelgfrelerevlldlplhdasviallgggrel
00462761   1/1  lrkll.gllsgGqkqrvadlvvlldadpevllaReptrgldpeteeeleellerleereplygadiviit
00503741   1/1  nvselldlkellrlllealglpppyq......lsggerlrvalaeallalgkpdllilDEitnlldpetl
00480471   1/1  llellkelkydpvilllnkidllddrllrraeaeer----------------------------------
00489571   1/1  ..........lallelrntteagaasgsrdkgllgklkpetraelldllre....egttilvvth.ldea
00512891   1/1  likelsggekqrvalarallakpdvlllDEid.gldpdvleallelleel.krsgvtvilttndldel.e
00478411   1/1  d.dlldrypdelsggqrqrvaiaralalepelllldeptsaldplavvellelllglnee..ldiilale
00493431   1/1  ldrdlsggqqlrvalaralvvfildpslelldeRlsgrdadtreeirkrlkrlleelgplieydyvivnd
00475521   1/1  ddellldrlp...sggqqqeilrvaiallilpvllgralallpelllldeptsaldpdlveei-------
00368571   1/1  lgvvildpgdgrsvrlnplaliddeedaaellralvsemgrgeddfftpaarallralilalaeepeptl
00510561   1/1  rrlgldldrlllldaltv...........................eellalaerllsggkvdlvviDslt
00515531   1/1  fpsltvlenlanvpillvlnKiDlleakeraeellellgl.gdlldklpselsgGqk-------------
00468951   1/1  ..arrlgld..................lddllllpaltveellala..........erllsggkpqlvvi
00490731   1/1  rggdlsgglrqr..larallgdydvliiDtp.gtldvllelallellkellaelgadvvllvvdatlgle
00515511   1/1  lesllvlenlanvpillvlnKiDlleaklvllllvglfdlldglpselsggqkq----------------
00379961   1/1  ...............lsggerqrvalaralalrpGllvlAdggvlllDEp.daldpevqaaLlrlleege
00477971   1/1  lldidpqglsggqkqrlalaralilppsllrgldep.ealdarle.raleellelae..gfdvvivnhdl
00496571   1/1  drvglsdlaygfprtlsglgqrqrvalarallkpdlvifldeppteeldeRlrkrl.........rlgdt
00475381   1/1  .....llgglvvildggvrqrlalarallldpdvllldeplllldaalrdlpdlvifldadpeell----
00498531   1/1  rrlgldldellllpal...........................tveellalaerllsggkpdlvviDslt
00484101   1/1  lieGl.lelalplilelrelsdgqiqrvaparallrdpllllldedtvvldkvdlasildlll-------
00478441   1/1  ddrypyelsggerqrvailr.vllp.klllpdepgrnldvlievavlnlilkllgidallelvd------
00487021   1/1  rvgl...lldrippalsgGqgqrvildrallselayqpdvllldeplsgldaklreelrdllrellpe.g
00406781   1/1  yvgelsgglrqrlalara..adpgvlllDEidalldarsgsgsggdsssrrvlnaLlrlleelrllsgvt
00387201   1/1  ----------------------------------------------------------------------
00404191   1/1  lvsklsgglqeqrvaiafalarkpdllllDEidalgldpelqeellelldelaer.gvtlilttnnrpee
00394721   1/1  sdlvgelegglrgllteala.lakpsvlflDEidrlldardsesslevlnaLlrlledgnvlviattnrp
00434401   1/1  dvydlsggerqr...aralasgpdvlilDgptlgldv.............lldlpdlvifvdhdlevale
00405881   1/1  ..............plldqpvellsggekqrlalarallgkpvilvlNKiDeptnel....dlellelle
00444381   1/1  ..................gselte..kelvGesegailsggfkqrvgia..lladpgilflDEidklldd
00533501   1/1  ldrvglsdlaydgfprllsgggrqrvalaralvvkpdlvilldeplevldeRlrkrgrlelrelds.eev
00356411   1/1  lilnltvlenvpiilvlNKiDlleekiveellellgleykgdrdpeelsggqkqrvalaral--------
00392701   1/1  yvgelsgglrqr..larallakpsvlllDEidklapkrsptsgldvelrrrvlnaLlrlleglrllsgvt
00379261   1/1  ...lvfltvlenirl....daseylekrvvsrligappgyvgyglggllteavrrlpysvllldelekah
00480251   1/1  vvliDtagglqrglllalaladlllvllldepllvldatagtellelakgllealgldgvvltkldlvaa
00420941   1/1  ..sellgkyvgelsgglrqllalara..akpsilllDEidklapkrsptsaldadvrrevlnaLlrlldg
00513761   1/1  yiliDtpGglelrallalllaiaralaadeillvddptsgldaetqleilelllelllklgipiilvlnK
00532471   1/1  ..............lsggqgqrvildrslysrpavlllllyvdeplsgldvelreelrdlleslllvlpl
00498811   1/1  elldllgldvvile.gplllsgglrqrpdlvifldappevlleRllkRggldeetiekrlelylelaply
00402371   1/1  yvgafegglrqllglaraa..kpgvlflDEidsllgarggsgvdpevqnaLlrlleegnvrviaatnrpe
00480441   1/1  lldgfprglsqaqalrlaldlvllldpslevlleRllgrgddteevirkrlerlapeleyyeelgladvv
00439861   1/1  adplglsgeellrvllalalelkpdlliiDeltalldaervrelrellralkrlakelgvtvilvsqlte
00477011   1/1  rleielpglpdltlvDtPGlgsvavvdqlsggqkqrvalarallknpdtlillvedand..ld-------
00451571   1/1  llgqaell.lsggkadlvifldaplevlleRllkrddekilkrleeqkqrvaiarallkkpa--------
00470731   1/1  dallrkgpdvildgagrtpeqlealldllee...................lgrpvvviilttnrevlldr
00437901   1/1  ......vddlsgyvgelsggeklrellaealteavlkgkpsvlllDEi.daldpdvlnallklldglrdl
00508671   1/1  elrdelrellkeaglpllvvfldaplevlleRdrrglypeelsgglkqrvaiarple-------------
00464411   1/1  drvglsdlaypgflsggeqqrvaiarallpkpdlvllldepteeldeRllkRg.....rllekleyikkr
00386741   1/1  daselsggeklrgllarala.kpgvlllDEida.ldpdvqeallelleegeltivgggllteldglllps
00499191   1/1  lvvlldryprllsggqrqrvaia.....dpdvlildgptllldpelrpladlvifldaspeelleRllkR
00511381   1/1  .....................qdpdviliDE.aqfldp....evvevllelad.tgilvlvtglemdfag
00482551   1/1  .........dlldll.ellerlrrllsegkvdlvviDslallarael..ldepllgldarelrellrlLk
00513251   1/1  .......gqkqrvalleaalkegylvvvDet..gldraqrlellelardlgrpv.lviflatspevlier
00527261   1/1  lkkllkklsellglsilgleli.lglsggdleelleelaellkklgkpvililDEiqsll.dvsskelle
00489631   1/1  .ledggvvlldgfdrsqlqrlailrallddppdlvvfldapleellerllkRdgrteeeilerlarleer
00367291   1/1  .........selleklvg..egegrlrgalaealradpgvlflDEidalagkrgsgtsrldpevqnaLlr
00410531   1/1  viwDtaGqerfrsllarylrgadgillvvdatdglsfeevaklleellglaglegvpiilvgnKlDlld-
00432181   1/1  DtpGleefa........sggekqrvalalallreadvlllvvdadeptsfldle....llell-------
00416171   1/1  ekgafgggekqrlgllrla..dggvlflDEidkl.....dpdvqnaLlrvleegeltrlgggivlpadvr
00521551   1/1  ..elvgkyvgelegglrqllalaraa..npgvlflDEidklapkrsptsglddvsrrrvlnaLlrllegl
00472911   1/1  .gllfedaleagfrqrladlirallakgkvvild..gtglsreareellellkelg...pvlvifldadp
00469161   1/1  srlayqlsggerqrlaidlegalllerllldepfpdlvifldaspeelleRllkRgreergrdldteevi
00437921   1/1  ....................................................kpdvlllDEi.drldpda
00517691   1/1  lplerergitidvalarllldgrkilllDt----------------------------------------
00499331   1/1  ldgf....pggllqrealrrllprpdlvilldappeelleRllkrgrldgreddslellekrleryeelt
00487061   1/1  ..............................gki.vlsarraqlleir-----------------------
00482721   1/1  dellaelsggqgdvliiegalllepgllplpdlvifldappevlleRllkRg...........gdseeei
00473941   1/1  lg......esdlrggfkqa........akpgvlflDEidrl.drevqnaLlelleelqvtilggglvvve
00410321   1/1  .lwDtaGqerfrsllllylrgadgvllVvdatdgdsfeevkellleilelaglagvpiilvgNKiDllea
00495771   1/1  ----------------------------------------------------------------------
00533151   1/1  ----------------------------------------------------------------------
00496061   1/1  fpldlegalllrealar.allpdlviflda----------------------------------------
00430121   1/1  ppg.yvGedelgvlfeaarkappsvlllDEidkl.....dpdvlnaLlqlleege.....vtdlggrvvd
00461621   1/1  prtleqaealskpavlsggrkqrlalaralavd-------------------------------------
00476071   1/1  galldglvygvlqdrllerllaagpdvlildgpl.lldvellplpdlvifldap----------------
00478391   1/1  ----------------------------------------------------------------------
00471271   1/1  ----------------------------------------------------------------------
00418301   1/1  ...........................aragigllaladpgvlflDEidkllpargssggdvsredvlna
00515351   1/1  ld....glsggllqrvallrallrpdlvifldapleelleRllkRd.dseeeilerleryreelepllee
00477721   1/1  ----------------------------------------------------------------------
00478131   1/1  ----------------------------------------------------------------------
00489391   1/1  ----------------------------------------------------------------------
00477561   1/1  ----------------------------------------------------------------------
00478081   1/1  eglllsdefrelleealalladgdvvilDgfgrlldarq..lleelllllleepppdlvifldadpevll
00519581   1/1  ...dleaverhlldiaeellengeilildeptvgldskd..ildelakilkevnfelifithdedelrer
00491901   1/1  ----------------------------------------------------------------------
00401211   1/1  ----------------------------------------------------------------------
00457851   1/1  eellaaggvildgfpldlegaealreallragplpdlvifldapleelleRllkrgreplddteevilkr
00509891   1/1  glcalvaddlagaleel.laralaggpdviliEgagllplpliellrdlldlvvlvvldgivllvdaidr
00512061   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           IADTIWFMADGRLLEIAETDTFFSAPQHEAAKEFLKGGTR------------------------------
00378981   1/1  thdlsealrladrilvlddGrivelgtpeellenp-----------------------------------
00422801   1/1  ellellrelak..gltvllvt-------------------------------------------------
00420701   1/1  hdlsealrladrilvlddGrivelgtpeellenpas----------------------------------
00390411   1/1  kelarllelleglkeea-----------------------------------------------------
00379581   1/1  lake.gltvllvthdldealrladrilv------------------------------------------
00509431   1/1  lkeleeeleligplldglellvglngl.ldrplse-----------------------------------
00490801   1/1  LDpetraellellrelake.gktvllvtHdlseal.----------------------------------
00510251   1/1  LDpetraellellrelake.gktvllvtHdlseal.----------------------------------
00440861   1/1  qdpnlfpglvvlisaltgegldeltvrenlal--------------------------------------
00482201   1/1  tvllvthdlsea.rladrilvlddGrivelgtpeellen-------------------------------
00367901   1/1  keeieeraeellellglgg.l-------------------------------------------------
00458601   1/1  ke.gltvllvtHdldealrladrilvlddGriveeg----------------------------------
00425571   1/1  sealaladrilvlddGrivelgtpeellenpaslyt----------------------------------
00482261   1/1  tvllvthdlseal.ladrilvlddGrivelgtpeellenp------------------------------
00361211   1/1  vthdldlldsallrpgkrpllsdlrgsgeieqladrvlvl------------------------------
00404101   1/1  hdldealrladrilvlddGrivelgtpeellenp------------------------------------
00475991   1/1  ellrelake.gltvllvtHdlsealrla------------------------------------------
00530591   1/1  ellrelak..gltvllvtHdlseal.ladrilvlddGr--------------------------------
00500441   1/1  tvllvthdlsealrladrilvlddGrivelgtpeell---------------------------------
00502741   1/1  hdldealrladrilvlddGrivelgtpeellenpgllytl------------------------------
00436071   1/1  aladrivvl-------------------------------------------------------------
00475891   1/1  tvllvthdldealrladrilvlddGri-------------------------------------------
00485451   1/1  rtiilvthdlreae..adrilvlrkgdivelgepq-----------------------------------
00468691   1/1  ptsgldalr..eilellrellkelgytvllvthdls----------------------------------
00466931   1/1  allleelllllglgdlldrpv-------------------------------------------------
00466971   1/1  ake.gltvllvthdldealrla------------------------------------------------
00372301   1/1  ladrvvvlndgrivavgtpeelyklpa-------------------------------------------
00424961   1/1  sdpdllllDeptsalDgeivls------------------------------------------------
00469451   1/1  ilvtH........Asdrvlvlrdgrivevg----------------------------------------
00436511   1/1  ftl-------------------------------------------------------------------
00496111   1/1  ilvthdleeaedladsgriavladgrivlegdlaelg---------------------------------
00498251   1/1  llellrrllrlakelgvtvllvthdlde------------------------------------------
00495371   1/1  lrlLkrlakelgvtvllvthdleeveel------------------------------------------
00488521   1/1  lLkrlakelgvtvllvthdldevarladr-----------------------------------------
00367481   1/1  gatvlvvtHdlelaalaadrivvl.ng-------------------------------------------
00379601   1/1  giitiegpdel......lrnkigyvfQdpvlfplt-----------------------------------
00457311   1/1  rlitrdlgeagrsadrvl....griveqgppeelfinp--------------------------------
00503371   1/1  nyeellklleeleell------------------------------------------------------
00500611   1/1  vtvllvthdlreveeladkrdrvvvlrg------------------------------------------
00422141   1/1  p............ieyvfqspnlfpl........------------------------------------
00371631   1/1  ralvedpdvlilDgptalldpltr.ellellkelrd----------------------------------
00468601   1/1  akgghdlslalrladrilvlgvGeivedgtpf--------------------------------------
00448931   1/1  vvthlDllakggadlslaleladrilvlgdGe--------------------------------------
00414121   1/1  gltvlivlnKiDllselthdlellreladrilvlgdg---------------------------------
00495031   1/1  lvthdlrevegrleladrvvvlrggril------------------------------------------
00485931   1/1  hddgtakggaalslaleladrilvlgdGeiv---------------------------------------
00532531   1/1  .......leladriyvllsGrivesgtteelltepk----------------------------------
00464791   1/1  lDEptsgldal..reil-----------------------------------------------------
00475371   1/1  vlkaadrilvldlgg-------------------------------------------------------
00381441   1/1  ----------------------------------------------------------------------
00437981   1/1  ellpallsrcqvirfpplseeelleil-------------------------------------------
00426051   1/1  adteeelleller---------------------------------------------------------
00437941   1/1  dpallsRfdviefpppdeeelleilkli------------------------------------------
00368501   1/1  rdgellkalkeaeaeellellglk.dlllrkpsql-----------------------------------
00462761   1/1  hdls.ieevadrilalleg---------------------------------------------------
00503741   1/1  spdvlelLlrlleegkltdkllgltliltthdldll----------------------------------
00480471   1/1  ----------------------------------------------------------------------
00489571   1/1  er.aDrvavldd......Gtpeellarpanpyvrellg--------------------------------
00512891   1/1  ladriallrrgrivelgplse-------------------------------------------------
00478411   1/1  ----------------------------------------------------------------------
00493431   1/1  dleealeelldiivvlllglilqpgslle-----------------------------------------
00475521   1/1  ----------------------------------------------------------------------
00368571   1/1  dellel----------------------------------------------------------------
00510561   1/1  alapalelsllldep-------------------------------------------------------
00515531   1/1  ----------------------------------------------------------------------
00468951   1/1  Dsltalrpallllde-------------------------------------------------------
00490731   1/1  aadrilvlleglgv--------------------------------------------------------
00515511   1/1  ----------------------------------------------------------------------
00379961   1/1  vtieragitlllpagvtviaatnddlgeld----------------------------------------
00477971   1/1  eealelldri------------------------------------------------------------
00496571   1/1  eevlehrleraeeladrlia--------------------------------------------------
00475381   1/1  ----------------------------------------------------------------------
00498531   1/1  alapslllldepgrv-------------------------------------------------------
00484101   1/1  ----------------------------------------------------------------------
00478441   1/1  ----------------------------------------------------------------------
00487021   1/1  ilpdlvifldadpeell.....eRllkRgreserge----------------------------------
00406781   1/1  viattndleeldpallrp----------------------------------------------------
00387201   1/1  ----------------------------------------------------------------------
00404191   1/1  ldqallrlls------------------------------------------------------------
00394721   1/1  ellgrl......eldpallrrfdv.ielgppdeeel----------------------------------
00434401   1/1  rrlkrlgr--------------------------------------------------------------
00405881   1/1  e....lggtvvlvSahdge---------------------------------------------------
00444381   1/1  rgeaegggdvsregvqnaLlrlleegell-----------------------------------------
00533501   1/1  lekrlehylellekadrvv---------------------------------------------------
00356411   1/1  ----------------------------------------------------------------------
00392701   1/1  viattnrpeeldpallrp----------------------------------------------------
00379261   1/1  rpirvlllsaslvlllgglg--------------------------------------------------
00480251   1/1  lgaalsvalilglpilflgtgenvddlevfnpgelvdr--------------------------------
00420941   1/1  lqalsnvtviattnrpeeldpallrpgRfdlviefplpdee-----------------------------
00513761   1/1  lDllseeglelvlelleellellpilllgvg---------------------------------------
00532471   1/1  ----------------------------------------------------------------------
00498811   1/1  gaadividnd.-----------------------------------------------------------
00402371   1/1  lvklgeldpallrRfdvielplpdleerl-----------------------------------------
00480441   1/1  ivnddleealell---------------------------------------------------------
00439861   1/1  lildalagggal----------------------------------------------------------
00477011   1/1  ----------------------------------------------------------------------
00451571   1/1  ----------------------------------------------------------------------
00470731   1/1  al.rRpgrllldep..eldppdreerleilkrllkklg.-------------------------------
00437901   1/1  sgvliilttndpe...........eldpallrRfd.iief------------------------------
00508671   1/1  ----------------------------------------------------------------------
00464411   1/1  lehylela--------------------------------------------------------------
00386741   1/1  gvlviattnrpel...........ldpallsRfdlv----------------------------------
00499191   1/1  grle------------------------------------------------------------------
00511381   1/1  elfegsllL-------------------------------------------------------------
00482551   1/1  rlakelgvtviltsqlt-----------------------------------------------------
00513251   1/1  lldrvllldegslvdlgvledll-----------------------------------------------
00527261   1/1  aLlrl-----------------------------------------------------------------
00489631   1/1  yradlvivtd------------------------------------------------------------
00367291   1/1  lleelrvlsgvlviattnrpeeldpall------------------------------------------
00410531   1/1  ----------------------------------------------------------------------
00432181   1/1  ----------------------------------------------------------------------
00416171   1/1  liaatnpdllelvlegelrpaLl-----------------------------------------------
00521551   1/1  edlsnvlviaatnrpe...........eldpallrp----------------------------------
00472911   1/1  evlleRllkrgrallreevldrl-----------------------------------------------
00469161   1/1  eerlervrdeylplaelykaadvlvidadldi....----------------------------------
00437921   1/1  qnallklleel..pagvtlilttnrle.........----------------------------------
00517691   1/1  ----------------------------------------------------------------------
00499331   1/1  rdlielyeeadrv---------------------------------------------------------
00487061   1/1  ----------------------------------------------------------------------
00482721   1/1  ekrler----------------------------------------------------------------
00473941   1/1  lllllpsgvlviaatnrpel...........ldpallsRf------------------------------
00410321   1/1  ----------------------------------------------------------------------
00495771   1/1  ----------------------------------------------------------------------
00533151   1/1  ----------------------------------------------------------------------
00496061   1/1  ----------------------------------------------------------------------
00430121   1/1  lsnviviat-------------------------------------------------------------
00461621   1/1  ----------------------------------------------------------------------
00476071   1/1  ----------------------------------------------------------------------
00478391   1/1  ----------------------------------------------------------------------
00471271   1/1  ----------------------------------------------------------------------
00418301   1/1  Llrlleegeltilgggvd----------------------------------------------------
00515351   1/1  yddalvvid-------------------------------------------------------------
00477721   1/1  ----------------------------------------------------------------------
00478131   1/1  ----------------------------------------------------------------------
00489391   1/1  ----------------------------------------------------------------------
00477561   1/1  ----------------------------------------------------------------------
00478081   1/1  ----------------------------------------------------------------------
00519581   1/1  ia--------------------------------------------------------------------
00491901   1/1  ----------------------------------------------------------------------
00401211   1/1  ----------------------------------------------------------------------
00457851   1/1  lerlrelyerliep--------------------------------------------------------
00509891   1/1  le--------------------------------------------------------------------
00512061   1/1  ----------------------------------------------------------------------