[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for bsub0:CAB13391.1


[Show Plain Result]

## Summary of Sequence Search
   1::494
  98::332  1.5e-77 42.5% 0046487 00464871 1/1   like peptide ligases, catalytic domain  
  63::348    5e-65 36.4% 0052866 00528661 1/1   like peptide ligases, catalytic domain  
 101::332    5e-57 40.5% 0038085 00380851 1/1   like peptide ligases, catalytic domain  
  92::330    1e-54 37.1% 0045483 00454831 1/1   like peptide ligases, catalytic domain  
  91::331    4e-52 36.8% 0042137 00421371 1/1   like peptide ligases, catalytic domain  
 333::491  2.7e-48 45.9% 0046486 00464861 1/1   like peptide ligases, peptide-binding d 
 332::477  3.8e-40 44.8% 0039392 00393921 1/1   like peptide ligases, peptide-binding d 
 335::478  1.9e-34 36.8% 0041698 00416981 1/1   like peptide ligases, peptide-binding d 
 333::472  2.2e-30 36.4% 0052865 00528651 1/1   like peptide ligases, peptide-binding d 
  88::331  2.3e-28 31.9% 0047522 00475221 1/1   like peptide ligases, catalytic domain  
   1::98   1.3e-27 42.9% 0038084 00380841 1/1   MurF N-terminal domain                  
   1::97   4.1e-27 46.7% 0036832 00368321 1/1   MurF N-terminal domain                  
 332::468  1.1e-22 24.8% 0048688 00486881 1/1   like peptide ligases, peptide-binding d 
  93::333    6e-11 22.3% 0041699 00416991 1/1   like peptide ligases, catalytic domain  
 332::457  8.5e-09 25.9% 0045482 00454821 1/1   like peptide ligases, peptide-binding d 
 333::472  0.00032 22.2% 0038083 00380831 1/1   like peptide ligases, peptide-binding d 
   1::494


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKLTKLLTYLTTEPSVNDSQDPEITSIEMDSREVKKGSLFVCVKGYTVDGHDFAQKAVENGAAAIVAERE
00464871   1/1  ----------------------------------------------------------------------
00528661   1/1  --------------------------------------------------------------vvlspalp
00380851   1/1  ----------------------------------------------------------------------
00454831   1/1  ----------------------------------------------------------------------
00421371   1/1  ----------------------------------------------------------------------
00464861   1/1  ----------------------------------------------------------------------
00393921   1/1  ----------------------------------------------------------------------
00416981   1/1  ----------------------------------------------------------------------
00528651   1/1  ----------------------------------------------------------------------
00475221   1/1  ----------------------------------------------------------------------
00380841   1/1  lilltlkellallgallllldvlisglslDsrkvkpgdlFvAlkGervdGhdfieqAlakGAvavlverd
00368321   1/1  mllsellsall.....lllldvlisglslDSRkvkpgdlFvAlkGervDGhdfieqAlakGAvavlverd
00486881   1/1  ----------------------------------------------------------------------
00416991   1/1  ----------------------------------------------------------------------
00454821   1/1  ----------------------------------------------------------------------
00380831   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           VDVNVPVIIVRQSLRALSVLSDAFYGQPTKKLQLIGITGTNGKTSTTHMVDEILKKAGKRTGLIGTMYMK
00464871   1/1  ---------------------------PsekltlvGvTGTnGKTtvalllaqllellglkaaliGTlgvl
00528661   1/1  lllplpviavelglealsrla.lllgnplkklpviaVtGTnGKttTtallasileaaglkvglytspglv
00380851   1/1  ------------------------------klpviavTGTnGKTTttsllaaileaaglvvalignignl
00454831   1/1  ---------------------dielalllldlpviavTGTnGKTTttsliaailkaaglvvalggnigvp
00421371   1/1  --------------------rlellarllldlpviavtGTnGKTTttallaaileaaglkvgaligninn
00464861   1/1  ----------------------------------------------------------------------
00393921   1/1  ----------------------------------------------------------------------
00416981   1/1  ----------------------------------------------------------------------
00528651   1/1  ----------------------------------------------------------------------
00475221   1/1  -----------------evlrraell.llrlklsiavaGthGKTTTtsllalvlleagldptfliGgiln
00380841   1/1  laldvpvivvddtllalgllaaafygkp------------------------------------------
00368321   1/1  lllklllvllllgvpvivvddlllalg-------------------------------------------
00486881   1/1  ----------------------------------------------------------------------
00416991   1/1  ----------------------ellglpqnalpvihvaGTnGKGstcaflesilraaglkvGlytSPhLl
00454821   1/1  ----------------------------------------------------------------------
00380831   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           IGDETLPVKNTTPESVTLQKTFKKMNDKHVDTAIMEVSSHALSLGRVHGCDYDIAVFTNLTQDHLDYHKT
00464871   1/1  lggellpaslTTpdalelqallaelveagvelvvmEvsshgLdqgRvdgvrfdvavftnltrdHLDyHgt
00528661   1/1  lfneriringepisdellarlfeevlnalegnlnlgigvpltpfelltllalllfadegvdvaVlEvgsg
00380851   1/1  igvp................allllldggvdvaVlEvssfdlgflldltnllrpdvavitnigldHldyh
00454831   1/1  .....................llllllegvdvaVlElssfql..grlellrpdvavitnispdHldrhgn
00421371   1/1  eigerltl..g..................gvdlaVlEvgssgllflt...lrpdvavitnigldHldylg
00464861   1/1  ----------------------------------------------------------------------
00393921   1/1  ----------------------------------------------------------------------
00416981   1/1  ----------------------------------------------------------------------
00528651   1/1  ----------------------------------------------------------------------
00475221   1/1  llgtnarl....................gdgdylvvEadesd...gsflllsPdiavitnidadHldiyg
00380841   1/1  ----------------------------------------------------------------------
00368321   1/1  ----------------------------------------------------------------------
00486881   1/1  ----------------------------------------------------------------------
00416991   1/1  dfnEriringepisdelllelfeeveaaleeldaegllsltfFelltllafllFaeakvdvavlEvGlGG
00454821   1/1  ----------------------------------------------------------------------
00380831   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           MDEYRHAKSLLFSQLGGAFNHEHPKRAVLNADDEASAYFEKVTAAHISTYGIKNDADVMAKNISITAQGT
00464871   1/1  meeYlaaKlrLFdll.......glglavinlddelgalllellsgalllvltyglkgdadgallraldle
00528661   1/1  gl.ldatnvldpdvavitniglDHldylgdtleeiaaaKagif.........kpggpavlnaddplvlav
00380851   1/1  gtleeyaaakaeifkgl......ppggvavlnaddpllaallerlagarvvtfglddegadlraldivll
00454831   1/1  slenyaaakleifegl.........gvavlnaddplllalae.lgakvitfgldedadllalll....gg
00421371   1/1  gtleaiaaakaeifkgl......ppggvavlnaddpllaelaeragarvvtfgldegadlraldivltld
00464861   1/1  ----------------------------------------------------------------------
00393921   1/1  ----------------------------------------------------------------------
00416981   1/1  ----------------------------------------------------------------------
00528651   1/1  ----------------------------------------------------------------------
00475221   1/1  gdledllaafleflnnv.........gllvlclddplllellg......ityGls.dadvralnillegg
00380841   1/1  ----------------------------------------------------------------------
00368321   1/1  ----------------------------------------------------------------------
00486881   1/1  ----------------------------------------------------------------------
00416991   1/1  rlDaTnvi........dplvavitsiglDHtdlLGdtleeIAleKaGiik.........pgvpvvlgdqe
00454821   1/1  ----------------------------------------------------------------------
00380831   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           SFDLVTNKGTKHITMSLVGQFNVYNVLAAVATCIAAGIPFEIITEAVEELHGVRGRFELVNQQQEFPVIV
00464871   1/1  lslsgllltlllpggelevslpLlGrfnvyNllaalalllalgldleevlaa------------------
00528661   1/1  leelaaevltfgllvgadlraedielsldglrftllgpgglllelelpllGrhnvlNalaAlaa....--
00380851   1/1  ldgtsftlllpggllevelplpgrhnvlNalaAiaaalalgvdleailegLa------------------
00454831   1/1  lllllllgllllllelplpglhnvlNalaAiaaalalgvdleaileaLes--------------------
00421371   1/1  gttftlllpgglllelrlplpGrhnvlNalaAiaaalalgvdleaiaegLa-------------------
00464861   1/1  ----------------------------------------------------vpGRfevlgevggptviv
00393921   1/1  ---------------------------------------------------GvkgRfellgelevggvlv
00416981   1/1  ------------------------------------------------------GRlevlse.ggplvil
00528651   1/1  ----------------------------------------------------lpGRlevls..ggplvll
00475221   1/1  gllfdvllkgellgeltlnlpGrHnvlNalAaiavalllgldleaileaLa-------------------
00380841   1/1  ----------------------------------------------------------------------
00368321   1/1  ----------------------------------------------------------------------
00486881   1/1  ---------------------------------------------------GvkrRfellgevalggggi
00416991   1/1  pealevlleraeelgapllllgrdfsllllelalggllllllglgllldlllp-----------------
00454821   1/1  ---------------------------------------------------glphRlevvlevngvlvin
00380831   1/1  ----------------------------------------------------vkgRlelvkllggvllid


                         -         -         -         -         *         -         -:420
query           DYAHTPDSLENVLETCRDMTEGKLFVVVGCGGDRDKTKRPKMAKIAVELADEPIFTSDNPRSEDPRAILR
00464871   1/1  ----------------------------------------------------------------------
00528661   1/1  ----------------------------------------------------------------------
00380851   1/1  ----------------------------------------------------------------------
00454831   1/1  ----------------------------------------------------------------------
00421371   1/1  ----------------------------------------------------------------------
00464861   1/1  DyAHnPdaleallealrefpggrliaVfgplgdkdtrkrlemlaialsladvviltddnprgedpeelaa
00393921   1/1  idDyAHhPdaieatlealrelfpdgrliavfgphgysrdkglrdefaeals.ladvviltdvnpagedpi
00416981   1/1  DgAHnpdaaeallealrelfpggrlilvfgalgdkd..irgllgllaelfddvvivtldnpraedpeela
00528651   1/1  DgAHnpdaleallealrellpgrlilvfgalgdkd..irgllgllaelfddvvivtldnprgalpaeila
00475221   1/1  ----------------------------------------------------------------------
00380841   1/1  ----------------------------------------------------------------------
00368321   1/1  ----------------------------------------------------------------------
00486881   1/1  tvidDYAHhPteikatlkalrelvpdrrivavfqphrysrtrdllkefaealsladlvvlldvyaagedp
00416991   1/1  ----------------------------------------------------------------------
00454821   1/1  DskatnpdateaAldala..adgkviliag.Gdgkgadfeplaallagrvralvligedaellaallgea
00380831   1/1  DsYnanpdsmkaaldllaslp.grkilvlGdmlElGeesaelhrelgellaelgidlvvlvGelaaalae


                         -         -         +         -         -         -         -:490
query           DMEAGVENAYYHSIANREQAIFFAIANAKKGDVVLIAGKGHETYQQIGNETFDFDDAEVAARAIVELNKN
00464871   1/1  ----------------------------------------------------------------------
00528661   1/1  ----------------------------------------------------------------------
00380851   1/1  ----------------------------------------------------------------------
00454831   1/1  ----------------------------------------------------------------------
00421371   1/1  ----------------------------------------------------------------------
00464861   1/1  allagilgglnvlviadraeaieaalelakpgdvvlvaGsghevgqiikllkllfddrevvleallelll
00393921   1/1  eilddillglligglkvlviedreeaielalslakpgdvvlilGagditgqiikllk-------------
00416981   1/1  allleggl..nvlviedvaeale......spgdlvlvaGslylvgevlqllggvklpf------------
00528651   1/1  lile......vlviadreeaieaalelad.gdlvlvaGslylvgevlkllle------------------
00475221   1/1  ----------------------------------------------------------------------
00380841   1/1  ----------------------------------------------------------------------
00368321   1/1  ----------------------------------------------------------------------
00486881   1/1  iegvdsellaeailkaggvdvlvvddleelielllellqpgdvvlvmG----------------------
00416991   1/1  ----------------------------------------------------------------------
00454821   1/1  a...........ivvesleeavelaaelaepgdvvll---------------------------------
00380831   1/1  al..........gevvhfddleelvelllellkpgdllvvLvkgsrsldler------------------


                         *         -         -         -         -         +         -:560
query           KTNS------------------------------------------------------------------
00464871   1/1  ----------------------------------------------------------------------
00528661   1/1  ----------------------------------------------------------------------
00380851   1/1  ----------------------------------------------------------------------
00454831   1/1  ----------------------------------------------------------------------
00421371   1/1  ----------------------------------------------------------------------
00464861   1/1  l---------------------------------------------------------------------
00393921   1/1  ----------------------------------------------------------------------
00416981   1/1  ----------------------------------------------------------------------
00528651   1/1  ----------------------------------------------------------------------
00475221   1/1  ----------------------------------------------------------------------
00380841   1/1  ----------------------------------------------------------------------
00368321   1/1  ----------------------------------------------------------------------
00486881   1/1  ----------------------------------------------------------------------
00416991   1/1  ----------------------------------------------------------------------
00454821   1/1  ----------------------------------------------------------------------
00380831   1/1  ----------------------------------------------------------------------