[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for bsub0:CAB13610.1


[Show Plain Result]

## Summary of Sequence Search
   1::442
  56::439    2e-84 36.0% 0049119 00491191 1/1   lisin-like                              
 123::441  2.8e-83 46.9% 0050066 00500661 1/1   lisin-like                              
 109::439  4.3e-82 44.0% 0042193 00421931 1/1   lisin-like                              
 106::439  1.1e-80 46.2% 0042014 00420141 1/1   lisin-like                              
 115::439  2.8e-80 48.2% 0053283 00532831 1/1   lisin-like                              
 124::439  5.1e-77 48.0% 0049659 00496591 1/1   lisin-like                              
 120::435  6.8e-77 46.2% 0036867 00368671 1/1   lisin-like                              
 123::439  8.3e-77 44.6% 0044989 00449891 1/1   lisin-like                              
 115::439  1.4e-76 48.6% 0044008 00440081 1/1   lisin-like                              
 115::439  2.9e-75 46.6% 0036337 00363371 1/1   lisin-like                              
 124::439  7.3e-74 42.3% 0043627 00436271 1/1   lisin-like                              
 124::440  9.2e-74 48.7% 0038041 00380411 1/1   lisin-like                              
 124::440  1.6e-72 47.4% 0040900 00409001 1/1   lisin-like                              
 124::440    6e-72 46.9% 0035548 00355481 1/1   lisin-like                              
 124::440  3.6e-71 46.9% 0036139 00361391 1/1   lisin-like                              
 123::439  1.8e-69 43.1% 0038019 00380191 1/1   lisin-like                              
 124::439  1.1e-67 41.2% 0038257 00382571 1/1   lisin-like                              
   1::442


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MFGYSMVQMVRANAHKLDWPLRETVLQLYKPFKWTPCFLHKFFETKLQNRKKMSVIIEFEEGCHETGFQM
00491191   1/1  -------------------------------------------------------kkvlklliililvlv
00500661   1/1  ----------------------------------------------------------------------
00421931   1/1  ----------------------------------------------------------------------
00420141   1/1  ----------------------------------------------------------------------
00532831   1/1  ----------------------------------------------------------------------
00496591   1/1  ----------------------------------------------------------------------
00368671   1/1  ----------------------------------------------------------------------
00449891   1/1  ----------------------------------------------------------------------
00440081   1/1  ----------------------------------------------------------------------
00363371   1/1  ----------------------------------------------------------------------
00436271   1/1  ----------------------------------------------------------------------
00380411   1/1  ----------------------------------------------------------------------
00409001   1/1  ----------------------------------------------------------------------
00355481   1/1  ----------------------------------------------------------------------
00361391   1/1  ----------------------------------------------------------------------
00380191   1/1  ----------------------------------------------------------------------
00382571   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           AGEVLQKEKRSKLKSRFNKINCCSAEVTPSALHSLLSECSNIRKVYLNREVKALLDTATEASHAKEVVRN
00491191   1/1  lllilllfltgnsavpkkyivvlkegpsldevlellsellklllgkleiydpvlngisvelseeqlkll.
00500661   1/1  ----------------------------------------------------Aellpwgldlinadeawd
00421931   1/1  --------------------------------------vllvpndplfsaqwgllnlslrlinadeawdl
00420141   1/1  -----------------------------------lkklpgvelvepdplvslqwglanislglllinat
00532831   1/1  --------------------------------------------vllpndpllllqwsldlinadaawd.
00496591   1/1  -----------------------------------------------------llslqwgldlinadaaw
00368671   1/1  -------------------------------------------------dpllsaqwgldlinadeawd.
00449891   1/1  ----------------------------------------------------lslqwgldlinadaawd.
00440081   1/1  --------------------------------------------vllndpllllltwlldligadaawd.
00363371   1/1  --------------------------------------------vlpndplllsatwlldlinaleawdl
00436271   1/1  -----------------------------------------------------lllttwtldllgalylw
00380411   1/1  -----------------------------------------------------llslqwgldlinalaaw
00409001   1/1  -----------------------------------------------------llslqwgldlinapaaw
00355481   1/1  -----------------------------------------------------llslqwgldlinadaaw
00361391   1/1  -----------------------------------------------------llslqwgldlinadaaw
00380191   1/1  ----------------------------------------------------pllglqwgldlinalyaw
00382571   1/1  -----------------------------------------------------llltqwtldflgalylw


                         +         -         -         -         -         *         -:210
query           GQTLTGKGVTVAVVDTGIYPHPDLEGRIIGFADMVNQKTEPYDDNGHGTHCAGDVASSGASSSGQYRGPA
00491191   1/1  el.pfvlsvepdpiielqkllqrlvlskavsrvlpdlnstllepndpllseqwglsrinvrdplye...g
00500661   1/1  ...gltG.gvtvaviDtGidydhpdlagrilggydfvgggndpdprddngHGThvAgiiagngnn.vg.v
00421931   1/1  ..gytgkgvvvaviDtGvdlnhpdlagnvlagadfvgngndpdpvplldplddngHGThvAgiiaaagnn
00420141   1/1  kawdl..gltgkgvvvaviDtGidynhpdLagnykvlggydfvdgdgdplpplddngHGThvAgiiaaag
00532831   1/1  .lgltgkgvvvaviDtGidldhpdlagrivggydfvdg...plddngHGThvagiiag.......gvvGv
00496591   1/1  dlgltgkgvtvaviDtGidpdhpdlagrilagadfvln.dsplddngHGthvagiiagagnn..ggvvgv
00368671   1/1  .lgytgkgvvvaviDtGvdpdhpdlagrvlggydfvdgdldpldsplddngHGThvAgiiagagvlnggg
00449891   1/1  ..gltgkgvvvaviDtGvdpdhpdlagnllagydlvgarnlldddpplddngHGThvAgiiag....ngg
00440081   1/1  ..gltgkgvvvavlDtGvdpdhpdlagrvlggydfvdgdndplddngHGThvAgiiagaglnglg.vvgv
00363371   1/1  ..gytgkgvvvavlDtGvdpdhpdlagrviggydfvdgdndpldlngHGThvAgiiagaglngvg.vvgv
00436271   1/1  dagltgkgvtvaviDtgvdydhpdlagffalgglaaggvdvvlpdgsplddnghgthvageial....dv
00380411   1/1  dlgytgkgvvvavlDtGvddhpdlagrviggydfvdg..dplddngHGthvagiiagagnn..ggvvgva
00409001   1/1  dlgytgkgvvvaviDtgvdpdhpdlagrvvggydfvdgd.dplddngHGThvagiiagagnn..ggvvgv
00355481   1/1  dlgytgkgvvvaviDtgvdpdhpdlagnvvggynf..vdgdplddngHGThvAgiiagagnn..vgvvgv
00361391   1/1  dlgytgkgvvvavlDtgvdpdhpdlagrvvggydfvdgdpd..ddngHGthvagiiagagnn..ggvvgv
00380191   1/1  dagytgkgvtvavidtgvdydhpdllgrflalfgydfvdntvvpiggaldgnghGThvageial....dg
00382571   1/1  dagltgkgvtvavidtgidythpdlagnfklgglpdfgvdlvvpdgsplddnghgthvageaaldv....


                         -         -         -         +         -         -         -:280
query           PEANLIGVKVLNKQGSGTLADIIEGVEWCIQYNEDNPDEPIDIMSMSLGGDALRYDHEQEDPLVRAVEEA
00491191   1/1  ltGkgvkvailDtGvdlnhpdlsdrvkagfdfvgndpdplpedaldnngHGThvagiiaGsdldvn..ll
00500661   1/1  vGvApslgaklvvvkvldsdgsgslsdilaaidyavdd......ngadvinlSlG......gpgyssala
00421931   1/1  gvg.vvGvapgakllavkvldgdg....sdiiaaieyav......nddgadvinlSlggsddgltldgll
00420141   1/1  nnglg.vvGvapgakllavkvld..gsgtlsdiaaaidyav.......d.gadvinlSlggsddgltldg
00532831   1/1  apgakllavkvldddgsgslsdilaaidyavddalslnllgvdvinlSlggp...ys....dalaaaida
00496591   1/1  apgakllvvkvldsdgsgslsdilaaidyavdd.......gvdvinlSlgg......pdysdalaaaida
00368671   1/1  vvgvapgakllavkvldddgsgtlsdilaaidyavddiv..alngadvinlSlgg......pddsdalaa
00449891   1/1  gvvgvapgakllavkvldadgsllgtlsdilaaidyavdd.......gadvinlSlggsl...dggysda
00440081   1/1  apgakllavkvldddgsgtlsdilaaidyavdd.......gadvinlSlggpdds......dalaaavda
00363371   1/1  apgakllavkvldddgsgslsdilaaidyavdd.......gadvinlSlgg......pddsdalaaavdl
00436271   1/1  egavGvApgakilaykvlg..gsgtlsdilaaidyavddg.......advislSlGgpesslplayldal
00380411   1/1  pgakllavkvldddgsgslsdilaaidwavdd.......gvdvinlSlggpdds......dalalavdaa
00409001   1/1  apgakllavkvldsdgsgtlsdilaaidyavdd.......gvdvinlSlggpe......ysdalaaavda
00355481   1/1  apgakllavkvldddgsgtlsdilaaidwavdd.......gvdvinlSlgg......pddsdalaaavda
00361391   1/1  apgakllavkvldddgsgslsdilaaidwavdd.......gvdvinlSlggpdds......dalaaaval
00380191   1/1  egavGvApgakillvkvldpggsgtlsdilaainyavn......ddgadvinlSlGgdeaslplsgysda
00382571   1/1  ggavgvApgakilaykvlg..gggstsdilaaidyavddg.......vdVislSlGgpesslplgyldal


                         -         *         -         -         -         -         +:350
query           WSAGIVVCVAAGNSGPDSQTIASPGVSEKVITVGALDDNNTASSDDDTVASFSSRGPTVYGKEKPDILAP
00491191   1/1  GvApnaklyivrvandisfldgssdpsdddvlaaldwald.......ngvdvinlSwg......pgdyss
00500661   1/1  aaideavakGvlvvaAaGNdgp..dtvsyPasspnvitVgatd.......adgtiasfSnrGpsv.....
00421931   1/1  llalsaalnaavdgavakgvlvvaAAGNdgpdadtlnvsspasspgvitVgAtdld.......gllasfs
00420141   1/1  lllllysaalnlavngavgkgvlvvaAaGNsgpdadnlsvsspasspnvitVgatdln.......gllas
00532831   1/1  avdkgvlvvaAaGNdgpda.tltypasapnvitVgavdsngl.......lasfsnrgp......kpdiaa
00496591   1/1  avakgvlvvaAaGNdgpdadlltvtypasspnvitVgatdld.......gllasfsnrgp......kpdv
00368671   1/1  avlaavakgvlvvaAAGNdgpdactvsspasspnvitVgatdldgslltl..vlasfssrgpstlaltts
00449891   1/1  lalavdlavakgvlvvaAAGNdgpdactvsypasspnvitVgatdldrsllalvelgngtlasfssrgpt
00440081   1/1  avakgvlvvaAaGNsgp..davsypasspnvitVgatdld.......gllasfssrgp......kpdiaa
00363371   1/1  avakgvlvvaAAGNdgpd..svsypasspnvitVgatdld.......gllasfssrgp......kpdvaa
00436271   1/1  alavllaaakGvtvvaAaGNsgpddgtldglfsvsyPasspyviaVGAtdldrsltgivletawsdglva
00380411   1/1  vakgvlvvaAaGNdgpd..tvsypasspnvitVgatdld.......gllasfsnrgp......kpdiaap
00409001   1/1  avakgvlvvaAaGNdgpdadnlsvsypasspnvitVgatdld.......gllasfssrgp......kpdi
00355481   1/1  avakgvlvvaAaGNdgpdadnlsvsypasspnvitVgatdld.......gllasfsnrgp......kpdi
00361391   1/1  avakgvlvvaAaGNdgpdadllsvsypasspnvitVgatdld.......gllasfsnrgp......kpdi
00380191   1/1  ldlafalavakGvtvvaAaGNsgaddllnndgllgslfsvsyPasspyvitVGAtdls.......dtlas
00382571   1/1  dlaflqavakGvtvvaAaGNsgpgggtlsnlfsvsyPasspyviaVGAtdldgsfasfsnlgssvllvgl


                         -         -         -         -         *         -         -:420
query           GVNIISLRSPNSYIDKLQKSSRVGSQYFTMSGTSMATPICAGIAALILQQNPDLTPDEVKELLKNGTDKW
00491191   1/1  alaeaidelvekGvlvvaaaGNdgpd.gsiiyPAdspnvivVGAvdstgerft....vasfSsrGp....
00500661   1/1  .divapGgnilsalpggqsllslllldglsllllgllslllllllglllldllldaslagllllldlsll
00421931   1/1  nrgpsvlgrlkpdvaapgvnilstlpg.............gglyatlsGTSmAaPhvAGvaAlllsanpn
00420141   1/1  fssrgps..gllkpdvsapgvnilstvpggg.............gyatlsGTSmAaPhvAGvaAlllsan
00532831   1/1  pGvnilstlpggg..............yatlsGTSmAaPhvAGvaAlllsanpdlspaqvkslllttatp
00496591   1/1  aapGvnilstlp..............gggyatlsGTSmAaPhvAGvaAlllsanpdlspaqvkallltta
00368671   1/1  dgrlkpdiaapGvnilstlp..............gggyatlsGTSmAaPhvAGvaAlllsanpnltpaqi
00449891   1/1  ldgrlkpdvaapGvnilstvpggllltgllll..lgggyatlsGTSmAaPhvAGvaAlllsanpnlllll
00440081   1/1  pGvnilstlp..............gggyatlsGTSmAaPhvAGvaAlllsanp..spaqvkslllttatp
00363371   1/1  pGvnilstlp..............gggyallsGTSmAaPhvAGvaAlllsanp..spaqvkalllttatp
00436271   1/1  sfSsgGpsvlfprPlyqagavvpylksllnssgrlkPdvaapGvnilsalpv............ggggya
00380411   1/1  Gvnilstlp..............gggyatlsGTSmAaPhvAGvaAlllsanpnlspaqvkslllttatpl
00409001   1/1  aapgvnilstlp..............gggyallsGTSmAaPhvAGvaAlllsanpnlspaqvksllltta
00355481   1/1  aapGvnilstlp..............gggyatlsGTSmAaPhvaGvaAlllsanpdlspaqvkallltta
00361391   1/1  aapgvnilstlp..............gggyatlsGTSmAaPhvAGvaAlllsanpnlspaqvrallltta
00380191   1/1  fsnygsavslvvllngllvgsgggfsvlfprpayqssagpnldgrlkPdvsapGvnilsali........
00382571   1/1  slsgggfsllfprplyqagavaafssrgpnpsgrlkPdvaapGvnilsalpl............lgggya


                         -         -         +         -         -         -         -:490
query           KDEDPNIYGAGAVNAENSVPGQ------------------------------------------------
00491191   1/1  ..kPdvsapGenilsawpg---------------------------------------------------
00500661   1/1  slslellkdlllllelllvag-------------------------------------------------
00421931   1/1  ltpaqirslllttatplgl---------------------------------------------------
00420141   1/1  pnltpaqvkslllttatpl---------------------------------------------------
00532831   1/1  ....pdllygyGlvnalka---------------------------------------------------
00496591   1/1  tplg..pdlvyGyGlldal---------------------------------------------------
00368671   1/1  ksllvttatplgllg-------------------------------------------------------
00449891   1/1  lspaqikalllttatpldl---------------------------------------------------
00440081   1/1  lg.gldlvygaGlldalka---------------------------------------------------
00363371   1/1  ld.gldlvygaGlvdalka---------------------------------------------------
00436271   1/1  vlsGTSmAaPhvAGvaAll---------------------------------------------------
00380411   1/1  g..ldllygaGlvdalkave--------------------------------------------------
00409001   1/1  tplg..pdlvygaGlldaak--------------------------------------------------
00355481   1/1  tplg..ldllygaGlldalk--------------------------------------------------
00361391   1/1  tplg..ldllygaGlldalk--------------------------------------------------
00380191   1/1  ....lpdggyalvsGTSmA---------------------------------------------------
00382571   1/1  vlsGTSmAaPhvAGvaAll---------------------------------------------------