[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for bsub0:CAB13612.1


[Show Plain Result]

## Summary of Sequence Search
   1::150
   4::145  6.7e-30 39.6% 0044408 00444081 1/1   like                                    
   1::145  4.6e-29 33.3% 0041204 00412041 1/1   like                                    
   2::143  1.6e-28 33.6% 0044862 00448621 1/1   like                                    
   1::145  2.9e-28 35.5% 0041625 00416251 1/1   like                                    
   4::145    4e-27 33.3% 0044506 00445061 1/1   like                                    
   6::143    9e-22 32.3% 0040990 00409901 1/1   like                                    
   1::143  6.8e-21 30.8% 0040616 00406161 1/1   like                                    
   1::150


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MADHHFYLKANWPGNRNDVGTIESGNLITSISIPKEMDGPGEGTNPDEMLLGAAATCYIITLAAMMERSG
00444081   1/1  ---ilytatatwtggrksgdgrvtsesgglelqldapkelgg.gegtnPeellaaalaaCfaiallavae
00412041   1/1  MselkilytatatwtggrdgtvssdggvldllldepvelggegetgtnPeellaaalaaCfalallavaa
00448621   1/1  -msllykvtvkwlggrrflattesg.helvldepkelggdgtgpnPvelllaalaaCtaitllaiakkkg
00416251   1/1  mdagrllllllellallklmkilytatatwtgglysrdgvvssddgvlelaldspkelggdgegtnPeel
00445061   1/1  ---ilytatatwtggrngtvtsedgaldlildepvelggedgsgtnPeellaaalaaCfllallaiaaka
00409901   1/1  -----mkvsvkwvgglrflatvgrg.....htilldeggddtgpnPeelllaAlagClaidllailkkkg
00406161   1/1  m.kilytatatatggrrgevts..sghellldlp..lggggegpnPeelllaalaaCflltlrlvakkkg


                         -         -         *         -         -         -         -:140
query           LEKEDLQMESEGIVNVTKGVFTYKKIIHRPSVVLKHDASQDDVALAHKLCKKAESSCMISRAIQGNVELQ
00444081   1/1  kkgidlesleveaevdldkeeggfgitkirltlevklpg....ldeeeaeklvekAhkvCpvskalrgni
00412041   1/1  kagielpedleveaevtldkdgggf.flkvtlrvtvpg......ldeeeaeelvelAhkvCpvsnalrgn
00448621   1/1  itldledlevevegerd.edgpgvftaieirltvelpgdldeee...leklvelalekyCpvsntlrggi
00416251   1/1  llaAlaaCfslallavaakkgievesleveaevdldkegdgfgftkirltlrvtlpg....ldeeqaekl
00445061   1/1  gidleseleveaevtldkegggff...ielrltvtlpg.ldeee...aeellelAhkvCpvskalrgnid
00409901   1/1  idledlevevegelde.egpfvftkieltvrvdgpdldeek.....lerlvelalekyCpvsrtlrggve
00406161   1/1  ipledlevevegdldldgedgpfgltsirlhvtl.....dgdldeeeaeellelaekvCpvsntlrgnie


                         +         -         -         -         -         *         -:210
query           LEASVKLGGE------------------------------------------------------------
00444081   1/1  evelt-----------------------------------------------------------------
00412041   1/1  idvel-----------------------------------------------------------------
00448621   1/1  evt-------------------------------------------------------------------
00416251   1/1  lelAh-----------------------------------------------------------------
00445061   1/1  velel-----------------------------------------------------------------
00409901   1/1  iev-------------------------------------------------------------------
00406161   1/1  vel-------------------------------------------------------------------