[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for bsub0:CAB13622.1


[Show Plain Result]

## Summary of Sequence Search
   1::700
 167::690   3e-165 36.4% 0042277 00422771 1/1   ike glycyl radical enzymes              
 167::700 1.6e-156 37.0% 0043302 00433021 1/1   ike glycyl radical enzymes              
   6::166  8.9e-51 43.5% 0042276 00422761 1/1   bunit of ribonucleotide reductase, N-te 
  73::682  8.9e-41 25.9% 0040352 00403521 1/1   ike glycyl radical enzymes              
  30::164  1.6e-15 25.6% 0049204 00492041 1/1   bunit of ribonucleotide reductase, N-te 
   1::700


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSQNQVPKWIQLNNEIMIQKDGKFQFDKDKEAVHSYFVDYINQNTVFFHNLKEKLDYLVENQYYEEEFLS
00422771   1/1  ----------------------------------------------------------------------
00433021   1/1  ----------------------------------------------------------------------
00422761   1/1  -----ttkyiekvaikvladeigveefdkdyeAaklylfalvksvygqFsslierldylveegyYddevl
00403521   1/1  ----------------------------------------------------------------------
00492041   1/1  -----------------------------kevlglfs..........igslyelikklveagllseelle


                         -         -         *         -         -         -         -:140
query           LYSFEDIKEVFKTAYAKKFRFPSFMSAFKFYNDYALKTNDKKKILERYEDRISIVALFFANGDTEKAKEY
00422771   1/1  ----------------------------------------------------------------------
00433021   1/1  ----------------------------------------------------------------------
00422761   1/1  kkysreeilyleeyayskkdffltflGalkfyekYllktrdtkkylEtfedrvllvaltLaqgelelakd
00403521   1/1  --rlslveeliellklevspalqplalpvflrkYsrktedgg.lretwdevveRvarglalleerllgal
00492041   1/1  fyskedleeldsaidperDllftYlGlktLedrYllkdridgeilElPQemfmrvAmgLalnekkedrld


                         +         -         -         -         -         *         -:210
query           VNLMINQEYQPSTPTFLNAGRKRRGELVSCFLLEVNDSLNDISRAIDISMQLSKLGGGVSLNLSKLRAKG
00422771   1/1  --------------------------lssCfllsvedslegildalkeaallskrggGvGlnlsnlRalg
00433021   1/1  --------------------------lssCfllsvedslegildalkeaallskrggGvGlnlsrlRalg
00422761   1/1  lldavllgrlqppTPtflgagkktRg--------------------------------------------
00403521   1/1  sseleelleeeleellellrnlkalPsGrilwlaGtdlikknasslfnCfvtgvrdsidgileivgevvd
00492041   1/1  lviefYdllsslkftlaTPtLfna----------------------------------------------


                         -         -         -         +         -         -         -:280
query           EAIKDVENATKGVVGVMKLLDNAFRYADQMGQRQGSGAAYLNIFHRDINDFLDTKKISADEDVRVKTLSI
00422771   1/1  slikgtggvssGvvpflkllddaaravnqggvRrgavavyldiwHpdilefldlkknegdeerrlrnlnl
00433021   1/1  slikgtggvssGvvpflkllddavravnqggvRrgavavylevwHpdilefldlkknngdeerrlrnlnl
00422761   1/1  ----------------------------------------------------------------------
00403521   1/1  kgeggisdafslaalllkrGgGvGylveprlinqlplvvneldvlvvldegsksyeerkelgllskyely
00492041   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           GVVIPDKFVELAREDKAAYVFYPHTIYKEYGQHMDEMDMNEMYDKFVDNPRVKKEKINPRKLLEKLAMLR
00422771   1/1  avlvpdlFmerveededwtlfspadvpglyladlygeefeelyerleadglivkktvkareLwrlilesa
00433021   1/1  avlvpdlFmerveededwtLfspadvpglydlallygeefeelylrleadglivkktvkareLwkkiles
00422761   1/1  ----------------------------------------------------------------------
00403521   1/1  degdiitivvgdsregWvkaladlldlsfddglldlvkvlvldfsdiRPaGaklkgfggtasGPvsllel
00492041   1/1  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           SESGYPYIMFQDNVNKVHANNHISKVKFSNLCSEVLQASQVSSYTDYDEEDEIGLDISCNLGSLNILNVM
00422771   1/1  letGePyllfkdtvnranpl..lgtikasNlCtEivlptspslllldllldelgevavCnLasinLakff
00433021   1/1  aletGePyilfkdavnranplknlggtikasNlCtEillptyplllvl....dllgevavCnLasinlak
00422761   1/1  ----------------------------------------------------------------------
00403521   1/1  lldvaeilnkaagrkltsvevldlldalavtvvsgGvRRsAqmall...hpdieefieaKddlwkldgrl
00492041   1/1  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           EHKSIEKTVKLATDSLTHVSETTDIRNAPAVRRANKAMKSIGLGAMNLHGYLAQNGIAYESPEARDFANT
00422771   1/1  dfeelrelvrlavraldnvidlnlydpvpearrgnlrlRsiGlGvmGladlLaklgipYdseealdladr
00433021   1/1  ffdfeelrelvrlavraldnvidlnlyp.lpearrgnlrlRsiGlGvmGladaLaklgipYdseealdla
00422761   1/1  ----------------------------------------------------------------------
00403521   1/1  gnfniSvlvddefm....................................................lwek
00492041   1/1  ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           FFMMVNFYSIQRSAEIAKEKGETFDQYEGSTYATGEYFDKYVSTDFSPKYEKIANLFEGMHIPTTEDWKK
00422771   1/1  ifeliyyaalraSvelAkergepfplfegskyakgllffdlldkllllllekvkelllllglllllkedw
00433021   1/1  drifeliyyaalraSvelAkerg.pfplfegskyakgllffdlld..........kvllslvllllkldw
00422761   1/1  ----------------------------------------------------------------------
00403521   1/1  ivlsaydsgEPGilfadeanernnaldgeelgyreeivgtNPCgEipLppyg.................a
00492041   1/1  ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           LKAFVAEHGMYHSYRLCIAPTGSISYVQSSTASVMPIMERIEERTYGNSKTYYPMPGLASNNWFFYKEAY
00422771   1/1  eelredikkyGlrNslllaiAPTgsisliagvtegiePifsnvylrkvlsgeflvvnpyllpdellavfk
00433021   1/1  eeLredikkyGlrNslllaiaPTgsisliagvtegiePifsnvylrkvlsgeflvvnpyl.lellavfkt
00422761   1/1  ----------------------------------------------------------------------
00403521   1/1  CnLgeinllafvfdledlfeavalavrfldnvtflt..lplevsrelalrdrriGvGftGladflvlafG
00492041   1/1  ----------------------------------------------------------------------


                         -         +         -         -         -         -         *:700
query           DMDMFKVVDMIATIQQHIDQGISFTLFLKDTMTTRDLNRIDLYAHHRGIKTIYYARTKDTGQDSCLSCVV
00422771   1/1  tafeidqedlidmaaarqpfvDqaiSltlflpedataedllklllyawklglKglyylrt----------
00433021   1/1  afeildqedlidmaaarqpfvDqaiSltlflpedaledgkltaedlldlllyawklglKtlyyyrtrs.k
00422761   1/1  ----------------------------------------------------------------------
00403521   1/1  levlrwwedagrpetgeglglkygseeaakfleslreivreaayeysvela.------------------
00492041   1/1  ----------------------------------------------------------------------