[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for bsub0:CAB14191.1


[Show Plain Result]

## Summary of Sequence Search
   1::233
   1::233    7e-51 27.8% 0045060 00450601 1/1   nosyl-L-methionine-dependent methyltran 
   9::225  8.8e-51 27.5% 0050762 00507621 1/1   nosyl-L-methionine-dependent methyltran 
   1::225  1.8e-50 29.2% 0042197 00421971 1/1   nosyl-L-methionine-dependent methyltran 
   1::234  4.6e-47 31.0% 0051842 00518421 1/1   nosyl-L-methionine-dependent methyltran 
   1::233    9e-47 28.0% 0040196 00401961 1/1   nosyl-L-methionine-dependent methyltran 
  11::233    1e-46 30.7% 0047386 00473861 1/1   nosyl-L-methionine-dependent methyltran 
   3::233  8.6e-46 29.1% 0051679 00516791 1/1   nosyl-L-methionine-dependent methyltran 
  18::233  4.3e-44 28.8% 0049171 00491711 1/1   nosyl-L-methionine-dependent methyltran 
   9::234  7.5e-44 29.0% 0047851 00478511 1/1   nosyl-L-methionine-dependent methyltran 
  11::225  9.8e-44 31.7% 0051239 00512391 1/1   nosyl-L-methionine-dependent methyltran 
   8::233  1.1e-43 29.1% 0049671 00496711 1/1   nosyl-L-methionine-dependent methyltran 
  14::222  1.2e-43 29.3% 0049122 00491221 1/1   nosyl-L-methionine-dependent methyltran 
   9::233    1e-42 30.3% 0050242 00502421 1/1   nosyl-L-methionine-dependent methyltran 
  13::218  1.5e-41 26.1% 0052807 00528071 1/1   nosyl-L-methionine-dependent methyltran 
  31::232  1.9e-41 29.1% 0050234 00502341 1/1   nosyl-L-methionine-dependent methyltran 
   7::232  5.5e-40 27.3% 0049074 00490741 1/1   nosyl-L-methionine-dependent methyltran 
  20::233  5.8e-40 26.9% 0047919 00479191 1/1   nosyl-L-methionine-dependent methyltran 
   5::235  2.6e-39 28.3% 0049719 00497191 1/1   nosyl-L-methionine-dependent methyltran 
   1::226  5.5e-39 24.5% 0047329 00473291 1/1   nosyl-L-methionine-dependent methyltran 
  32::225  5.5e-39 29.5% 0051143 00511431 1/1   nosyl-L-methionine-dependent methyltran 
   3::234  1.3e-38 28.4% 0051103 00511031 1/1   nosyl-L-methionine-dependent methyltran 
   7::225  1.4e-38 28.9% 0041444 00414441 1/1   nosyl-L-methionine-dependent methyltran 
   9::233  5.1e-38 27.1% 0046354 00463541 1/1   nosyl-L-methionine-dependent methyltran 
   8::233    9e-38 26.8% 0046838 00468381 1/1   nosyl-L-methionine-dependent methyltran 
   1::230  4.9e-37 31.1% 0049885 00498851 1/1   nosyl-L-methionine-dependent methyltran 
   1::178    5e-37 26.0% 0046696 00466961 1/1   nosyl-L-methionine-dependent methyltran 
   1::234  6.4e-37 28.1% 0051657 00516571 1/1   nosyl-L-methionine-dependent methyltran 
  12::218  8.3e-37 27.9% 0046931 00469311 1/1   nosyl-L-methionine-dependent methyltran 
   2::232  9.9e-37 28.4% 0052536 00525361 1/1   nosyl-L-methionine-dependent methyltran 
   1::233  1.4e-36 26.2% 0046840 00468401 1/1   nosyl-L-methionine-dependent methyltran 
  25::218  1.4e-36 30.3% 0040829 00408291 1/1   nosyl-L-methionine-dependent methyltran 
  21::221    2e-36 29.3% 0052649 00526491 1/1   nosyl-L-methionine-dependent methyltran 
  10::233  5.9e-36 27.3% 0053077 00530771 1/1   nosyl-L-methionine-dependent methyltran 
  17::232  2.4e-35 27.6% 0052709 00527091 1/1   nosyl-L-methionine-dependent methyltran 
   3::217  3.6e-35 24.8% 0050935 00509351 1/1   nosyl-L-methionine-dependent methyltran 
   8::222  5.9e-35 31.4% 0050154 00501541 1/1   nosyl-L-methionine-dependent methyltran 
   7::219  8.7e-35 30.9% 0047656 00476561 1/1   nosyl-L-methionine-dependent methyltran 
   5::176  9.1e-35 30.1% 0037982 00379821 1/1   nosyl-L-methionine-dependent methyltran 
  15::173  1.1e-34 25.5% 0047923 00479231 1/1   nosyl-L-methionine-dependent methyltran 
  20::222  1.2e-34 27.2% 0051449 00514491 1/1   nosyl-L-methionine-dependent methyltran 
   1::232  2.2e-34 27.4% 0050919 00509191 1/1   nosyl-L-methionine-dependent methyltran 
   5::233  2.1e-33 26.0% 0051261 00512611 1/1   nosyl-L-methionine-dependent methyltran 
   6::192  2.4e-33 23.0% 0049474 00494741 1/1   nosyl-L-methionine-dependent methyltran 
  11::221  2.8e-33 28.3% 0048805 00488051 1/1   nosyl-L-methionine-dependent methyltran 
   2::218  4.2e-33 21.6% 0048490 00484901 1/1   nosyl-L-methionine-dependent methyltran 
   8::224  4.4e-33 29.5% 0046744 00467441 1/1   nosyl-L-methionine-dependent methyltran 
   1::221  4.6e-33 26.9% 0044689 00446891 1/1   nosyl-L-methionine-dependent methyltran 
  13::221  1.4e-32 26.5% 0047211 00472111 1/1   nosyl-L-methionine-dependent methyltran 
   1::183  2.2e-32 23.2% 0047676 00476761 1/1   nosyl-L-methionine-dependent methyltran 
  37::198  2.6e-32 28.7% 0047945 00479451 1/1   nosyl-L-methionine-dependent methyltran 
  14::218  3.6e-32 29.7% 0045109 00451091 1/1   nosyl-L-methionine-dependent methyltran 
  30::231  3.9e-32 28.8% 0049532 00495321 1/1   nosyl-L-methionine-dependent methyltran 
  13::178  2.2e-31 25.5% 0050745 00507451 1/1   nosyl-L-methionine-dependent methyltran 
  15::221  2.3e-31 24.0% 0049915 00499151 1/1   nosyl-L-methionine-dependent methyltran 
  29::185  6.9e-31 28.9% 0051617 00516171 1/1   nosyl-L-methionine-dependent methyltran 
   3::224  2.2e-30 24.2% 0040964 00409641 1/1   nosyl-L-methionine-dependent methyltran 
  12::177  2.2e-30 25.2% 0050988 00509881 1/1   nosyl-L-methionine-dependent methyltran 
  25::197  2.5e-30 25.6% 0046568 00465681 1/1   nosyl-L-methionine-dependent methyltran 
   7::156  3.9e-30 30.6% 0044550 00445501 1/1   nosyl-L-methionine-dependent methyltran 
   2::216    8e-30 28.5% 0043085 00430851 1/1   nosyl-L-methionine-dependent methyltran 
  12::222  1.1e-29 28.5% 0048629 00486291 1/1   nosyl-L-methionine-dependent methyltran 
  11::202  1.5e-29 25.4% 0048438 00484381 1/1   nosyl-L-methionine-dependent methyltran 
  11::173  2.7e-29 29.2% 0041593 00415931 1/1   nosyl-L-methionine-dependent methyltran 
   5::181  3.8e-29 25.7% 0053107 00531071 1/1   nosyl-L-methionine-dependent methyltran 
   7::222    4e-29 28.7% 0041580 00415801 1/1   nosyl-L-methionine-dependent methyltran 
  10::232    5e-29 28.0% 0040327 00403271 1/1   nosyl-L-methionine-dependent methyltran 
  30::162  3.6e-28 26.4% 0051823 00518231 1/1   nosyl-L-methionine-dependent methyltran 
  30::162  6.2e-28 30.2% 0051930 00519301 1/1   nosyl-L-methionine-dependent methyltran 
  37::199    8e-28 24.7% 0047471 00474711 1/1   nosyl-L-methionine-dependent methyltran 
  30::202  8.7e-28 25.3% 0050519 00505191 1/1   nosyl-L-methionine-dependent methyltran 
  32::155  9.7e-28 32.8% 0051884 00518841 1/1   nosyl-L-methionine-dependent methyltran 
  47::177  1.1e-27 27.7% 0051885 00518851 1/1   nosyl-L-methionine-dependent methyltran 
  10::175  2.2e-27 23.0% 0052182 00521821 1/1   nosyl-L-methionine-dependent methyltran 
  15::215  6.5e-27 23.6% 0047465 00474651 1/1   nosyl-L-methionine-dependent methyltran 
   6::234  8.4e-27 26.8% 0047580 00475801 1/1   nosyl-L-methionine-dependent methyltran 
  20::232  3.2e-26 23.3% 0052894 00528941 1/1   nosyl-L-methionine-dependent methyltran 
   3::189    1e-25 22.3% 0051840 00518401 1/1   nosyl-L-methionine-dependent methyltran 
  27::219  4.1e-25 28.6% 0042682 00426821 1/1   nosyl-L-methionine-dependent methyltran 
   4::232  7.5e-25 25.8% 0036610 00366101 1/1   nosyl-L-methionine-dependent methyltran 
   8::157  3.3e-24 33.6% 0049778 00497781 1/1   nosyl-L-methionine-dependent methyltran 
  38::173  3.8e-24 24.4% 0051944 00519441 1/1   nosyl-L-methionine-dependent methyltran 
   1::155  1.5e-22 26.1% 0052618 00526181 1/1   nosyl-L-methionine-dependent methyltran 
   3::234  2.3e-22 20.4% 0039093 00390931 1/1   nosyl-L-methionine-dependent methyltran 
   7::234  2.3e-22 27.8% 0047862 00478621 1/1   nosyl-L-methionine-dependent methyltran 
  15::172  2.7e-21 24.0% 0049442 00494421 1/1   nosyl-L-methionine-dependent methyltran 
   1::219  1.1e-20 26.7% 0041326 00413261 1/1   nosyl-L-methionine-dependent methyltran 
  29::188  2.7e-20 23.6% 0048774 00487741 1/1   nosyl-L-methionine-dependent methyltran 
  46::225  4.5e-20 20.7% 0053229 00532291 1/1   nosyl-L-methionine-dependent methyltran 
   2::188  8.8e-20 21.7% 0050749 00507491 1/1   nosyl-L-methionine-dependent methyltran 
   7::205  1.5e-19 22.8% 0052001 00520011 1/1   nosyl-L-methionine-dependent methyltran 
  29::153  3.6e-19 29.2% 0049069 00490691 1/1   nosyl-L-methionine-dependent methyltran 
  12::154    4e-19 25.0% 0053110 00531101 1/1   nosyl-L-methionine-dependent methyltran 
  13::153  1.8e-18 27.3% 0047303 00473031 1/1   nosyl-L-methionine-dependent methyltran 
  24::175  5.9e-18 21.7% 0035026 00350261 1/1   nosyl-L-methionine-dependent methyltran 
  29::155  8.4e-18 27.4% 0052084 00520841 1/1   nosyl-L-methionine-dependent methyltran 
  35::156    4e-16 26.1% 0052510 00525101 1/1   nosyl-L-methionine-dependent methyltran 
  29::186  1.2e-15 22.3% 0053087 00530871 1/1   nosyl-L-methionine-dependent methyltran 
   9::194  1.3e-15 19.8% 0052982 00529821 1/1   nosyl-L-methionine-dependent methyltran 
   7::151  5.4e-13 23.8% 0048524 00485241 1/1   nosyl-L-methionine-dependent methyltran 
  18::151  8.8e-13 23.3% 0052739 00527391 1/1   nosyl-L-methionine-dependent methyltran 
   9::177  9.8e-12 17.1% 0050693 00506931 1/1   nosyl-L-methionine-dependent methyltran 
   9::180  4.2e-11 18.6% 0052749 00527491 1/1   nosyl-L-methionine-dependent methyltran 
  17::218  2.8e-07 18.4% 0049186 00491861 1/1   nosyl-L-methionine-dependent methyltran 
  40::184  2.8e-07 21.3% 0052693 00526931 1/1   nosyl-L-methionine-dependent methyltran 
  21::157  7.4e-06 22.4% 0043276 00432761 1/1   )-binding Rossmann-fold domains         
  43::151  0.00035 25.7% 0038379 00383791 1/1   )-binding Rossmann-fold domains         
  43::122  0.00045 29.7% 0036976 00369761 1/1   nosyl-L-methionine-dependent methyltran 
   1::233


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MQDSKEQRVHGVFEKIYKNYDQMNSVISFQQHKKWRDKTMRIMNVKEGAKALDVCCGTADWTIALAKAAG
00450601   1/1  MssteklsplliehkelveefydslaerydelrgvllrpaqrallelllellgllpgkrvLDvGCGtGll
00507621   1/1  --------veehydelaefydkllgelliprpateellelllellglkpgkrvLDlGCGtGrlalalakr
00421971   1/1  Msdcplcpesltpsellykeevarvfdriaerydrlrpvpsplyyllgddeeayldlllfpgagiprpla
00518421   1/1  Mkek....vkeyydelaerydllrgslplrpaaealldlllellp..pggrvLDlGcGtGrlalalaer.
00401961   1/1  Msk......kdlkeavaeyydlfadfydllldpnfhysygyfsgefldleeaqerlldlllellglkpgk
00473861   1/1  ----------melfdevaeryddfadglspgqdrllel.llellaellkpgkrvLDiGcGtGglalalak
00516791   1/1  --vlgnddyqeefdpealadefyalaseydpldrllllllerllell...slglkpggrvLDvGcGtGll
00491711   1/1  -----------------skyywd......efyrplldallellglkpgkrvLDlGCGtGglllalarl.g
00478511   1/1  --------klkksfdnvakhYdlgndlyslildpdmfysygyyddpdetlrpaqelllelllellglkpg
00512391   1/1  ----------elydklaefYdkllg..srllyeelldlllellpelllkgkrvLDlGCGtGrltlalakr
00496711   1/1  -------nsvsglfdsiashydllndlyellldedyfysygyfddyglglrpaqeallelllellglkpg
00491221   1/1  -------------mstvplselskklaeeffydlaadfydllld.glfpsqrelldlllellglkpgkrv
00502421   1/1  --------dvkdfydelaelyddlldelsd....alldlllellglkpgkrvLDiGcGtGglalal....
00528071   1/1  ------------fdsyayfydalnllqlrprtealleallellglkpgkrvLDlGcGtGglalalakr.g
00502341   1/1  ------------------------------al..klelllellglkpgkrvLDiGcGtGglalalakrg.
00490741   1/1  ------ledllrayllllpellllleslenladhldlgnppfelllgeeffeyfakvyelydafndglr.
00479191   1/1  -------------------Ydlgndlyellldedyfysdayyddpgdllrpaqerllelllellglkpgk
00497191   1/1  ----llllralllllelvelllelleklldsllkgeipfeyllgedffeyfdddaelydgfndgls.gaq
00473291   1/1  vkllkegdrvllelgrplmllellregglldtrlgiepledllgvprglfldlavgylvlilrpltedlv
00511431   1/1  -------------------------------qrellelllellglkpgkrvLDiGcGtGglalalakrgp
00511031   1/1  --kllelldldidllklsllklkkinklyknlknlilkntsnvskeeiakfydlvadffdevaayydglf
00414441   1/1  ------tysagyydlpadilrpat........eelldlllellglkpgdrvLDlGcGtGglalalaravg
00463541   1/1  --------renlvdnlaehydllnevleallkvprelflpevplrelayedeflpitlevgegllisqpe
00468381   1/1  -------edsllplllllldpllleallslleallegkydllellfgkelfeylagdaelydlfndglrp
00498851   1/1  darlllglllglslllleayldlvldeeelerllellerlaerypllksllselndrdweeaylkglrpf
00466961   1/1  dlsndlyelyldlydlyssaydllgdrpltda...lleallellglkpgkrvLDlGcGtGglalalakr.
00516571   1/1  pedevkelirsfydraadrydgqnrlleelgdgvmlaqerallrllallglrpggrvLdvGcGtGllala
00469311   1/1  -----------erlfdeyaefydlanglglrprqeallelllellplkpgkrvLDlGcGtGglalalak.
00525361   1/1  -lkvdkeeiakfydlaaeyydlvyatedgylgglflfngadleesaefladlllellgllpgkrvLDvGc
00468401   1/1  lslapllllllddvlleawlslldallegrldllellyglglfeylaldaevydafldglr.patellld
00408291   1/1  ------------------------vlipfehqevlleellellklkpgkrvLDlGcGtGglalalakllp
00526491   1/1  --------------------ddlyddglsliqrell.elllelldlllkpgkrvLDiGcGtGglalalak
00530771   1/1  ---------keyydeiaery........dpaqrallelllellgllpggrvLDlGCGtGrlalalarr.g
00527091   1/1  ----------------qnhYDlsndfyelfldpsmtyssgyfedpgesleeaqeakldllldklglkpgk
00509351   1/1  --nmllelllklllllglnlseeqyekledyfdllldwnkkynllsskdpdrlwerhildsllllelldl
00501541   1/1  -------dvaeyfddiaavydgfaeglr.eaaeallelllellp..pgkrvLDiGcGtGglalalakr..
00476561   1/1  ------dlyndlfelfldhssey.alinqllleelvellldlldlkpglkvLDiGcGtGelalalakklp
00379821   1/1  ----vvedvldafrlvsknlflgervygegvvkpqdegatiwaphrsrlaaklaeilelldlkpGdrVLD
00479231   1/1  --------------efyddyalsfdeglrptqeellelllellglkpgkrvLDlGcGtGglalalaklgp
00514491   1/1  -------------------GadeyfefgpryiqepllelllelldlllkpgkrvLDiGcGtGglalalak
00509191   1/1  klleleedvrslfldyaelydgdnllleelgdgvmraqeralmallallglrpggrVLDvGcGtGglala
00512611   1/1  ----lagkvydlfyivprgefllldptledsvlifkrgteilqpadlalilellglkpgdrvLDiGcGsG
00494741   1/1  -----kngikdeilldyilsrprgepldelldeyedyalkfgl.glliiqpellalllelldlkpgkrvL
00488051   1/1  ----------vnvlkidseevleallkegrellltpglvpgksvygedygdplgeearlwdprrsrlaak
00484901   1/1  -lllldkllkllkpgdlvllllannlllpltlrvnklkltrfgllnvlelsgknavahydlsndvyelll
00467441   1/1  -------ikrlvvllvlkglllsrlladalilvprhydlgedlygeelakvyddlaafldg.....lrsr
00446891   1/1  Mveklirkhyildeevleaflkvprelfvpeplyslayfdglealkflgqnflsapellalllelldlkp
00472111   1/1  ------------nsdmsddefdpkkyldefyddyagrffrlr.eilrllldellallgllpggrvLDvGc
00476761   1/1  lldllsllllelglvlsdeqleklealldllldwnpvinltgsrefdelwlrvlldllallplkpgkrvL
00479451   1/1  ------------------------------------etlgellklrlnklikeefdlgnkfsklwldrsv
00451091   1/1  -------------ddlakflgqn.....fltdpellelilellnlkpgdtvLDiGcGtGaltlalaklgp
00495321   1/1  -----------------------------tigellrealalleeagldlldaelllllllgldrlrllll
00507451   1/1  ------------llvlllllllalnkalkllrdllrklglpayrlvlgegdllrglavdrygdwlvvlll
00499151   1/1  --------------Llvlgllielltpglrlllkvdelllserskyqeirvyelgddgrvllldgllqgs
00516171   1/1  ----------------------------QnfltdpalldailellglkpgdrVLDiGcGtGaltlalakr
00409641   1/1  --wfterltpekafslkveevlyeakseyqqiflvdsevfgkllfldgvlqsterlefpyhealahllll
00509881   1/1  -----------kalldillwliellslglalslkidklleeekskyqiiriydlgnfgyelfldgrllys
00465681   1/1  ------------------------gyvsrgalklqe..lleklgllkpgervLDlGcGpGgltlvlaerv
00445501   1/1  ------drveppcphfgecggcqlqhlsyeaqlelkknlleellkrlgptifsplplgyrnkaelvvrvd
00430851   1/1  -msetetdfglarlklieeliashydlsvdvlealldvpreyfvlepayedlalafgtgvhilrpellal
00486291   1/1  -----------sydniaihydmlndrpr...tealleallellgllkgkrVLDvGcGtGilslalaka.G
00484381   1/1  ----------seildglvivgkydlskdlfeeflgdydlvlafldglrsraerllelllellglkpgkrv
00415931   1/1  ----------mevelmkilvtdpeelglvsklnekrlkaleeilsviqnvneelleailavlrrvllpsn
00531071   1/1  ----Gplriilgefrglklkvd..pgvlirpttdrlrelllelladllkgkrvLDlgcGtGglalalak.
00415801   1/1  ------mekkelldwiaelldlgldlykleaellldevlgldraglllgdrgltleelakflelierrle
00403271   1/1  ---------dgdsllplvllelsdellrafldllealregepafelafgkdffeylakdpdlalrflggm
00518231   1/1  -----------------------------idcallaerlnkalellkdllkklevlrlilregdglpgla
00519301   1/1  -----------------------------vllslfaerlvealkllkklllkglvnayrlvlgegdllrg
00474711   1/1  ------------------------------------ldgwfteilwpglrlllkldellheekskyqiir
00505191   1/1  -----------------------------lHipvlleellellapkpggrvlDlgcGtGghslalaerg.
00518841   1/1  -------------------------------dlikegdlvllllsrgnlllvllkllneggvlntrygvl
00518851   1/1  ----------------------------------------------eldgqlldlllklikeklkknlgl
00521821   1/1  ---------diteeelleyvlrhsfvpdpllllalrdealdvggglpilspekgalllellrllpgkrvL
00474651   1/1  --------------leddllplliryslpdwlvellldllgeeleallealllplpldlrvntlkislee
00475801   1/1  -----medleearkklvelllrnngilnlrvldalervprehfvpsllgylafldlplafgegvlisqpe
00528941   1/1  -------------------ylg.dydklrllrsnlaeqllsllalrrglrilDlGcGtGalllalaevlp
00518401   1/1  --qvmlklikkqikeypqdklvripekaslyllvlealltglnllqrllaafllelldlfkgkrvLdiGa
00426821   1/1  --------------------------qnfltdpeilekilelldlkegdrvLdiGcGtGaltlelakrgg
00366101   1/1  ---mserliklepekyillelkflgl.rfkvdpgvffptgldldtelllelldlkkgkrvLDlGcGtGil
00497781   1/1  -------vlakvlllkllsklflglltvrlwdgtvtfggglktsifltildvlpillalilvldsisyrr
00519441   1/1  -------------------------------------slprwlvinllkllgeellealleallellplv
00526181   1/1  lqeitedllellfnallllienlldgaldalleilpellgllflldlllddellrelldllseidlseid
00390931   1/1  --eeffelfrdigkkydgwyfeepllpglalsykvdrvlhegkspyqeililespdfgrllvldgvvqls
00478621   1/1  ------llelkwieelkkklgvvdervldrlreikfddivpegeyyglpllisrglttsspelasylvaa
00494421   1/1  --------------lpgllidrliqllgeelealleallealplllrvntlkisldellelleglgielr
00413261   1/1  rskrvpleyilgeadfyglpldvgga..fltprpitellleallelgllkgkrvLDlGcGtGilaialak
00487741   1/1  ----------------------------hqnfvnpllakllealdlrpgdrVLdlgcGtGrlalaLakr.
00532291   1/1  ---------------------------------------------lllgllwltetltpglalslkvdev
00507491   1/1  -egeplriilgkleglklkldpgqa...fltprpvtellvdallelgllkgkrvlDlGaGtGalslalak
00520011   1/1  ------llletliellldlgrdllldervddylrdlikglpeallaledfadllykyaylfswrgrliik
00490691   1/1  ----------------------------QnfltdpnlldkivelldlkpgdrvLEiGcGtGaltlaLakr
00531101   1/1  -----------fanrlnkalklrkkllkklgldayrlfdglpglvvdrygdvlviqvtsagalklkdalv
00473031   1/1  ------------prellkeflkakkslgqn.....fltdpnladkivelldllpgdlnleglrvLeiGcG
00350261   1/1  -----------------------nvTsffrdpehfdalaelllpllpglrvLdlGcGtGeepyslamlll
00520841   1/1  ----------------------------elvlsslmdaefWderydegetgfdlgepnpllvefleallg
00525101   1/1  ----------------------------------ladvlanvlldirksekvldlGcGtGlllialael.
00530871   1/1  ----------------------------fyTPreivellvelldpkpggrvlDpgcGsGgfllalaerll
00529821   1/1  --------vsidfvrrflvkliekiilrswrgldiilsagylipgilgregteqlldsal..........
00485241   1/1  ------rayelplqyitgeldfsglelhvrgyvpaliprpltellaaallrllgldpg.tvlDpgCGsGt
00527391   1/1  -----------------ypmriiagkfrgrkllvppglftrpttdrvreallnilapllpgarvLDlgaG
00506931   1/1  --------llriiggkfrgrkllvppgprptterlrealfnllllllleggrvLDlgaGsGalaleaasr
00527491   1/1  --------Peelldglpglfdiigdiavvnlneellplkdliaeallekpgvksvllkngidgefrlgel
00491861   1/1  ----------------dklvtallvlaarakesarpdgylpslklDpyaaylvdriaaealrlllgldlf
00526931   1/1  ---------------------------------------lriiaGqfrgrkldvpdglitrpttdrvrea
00432761   1/1  --------------------lplelaaalglalltavlavlaagvkpgktvlvlGaGgvGlaaaqlakal
00383791   1/1  ------------------------------------------pkdvdlrvllllpeigltalealkrall
00369761   1/1  ------------------------------------------llskpgdlVLDpfaGsGttaiaaaklgr


                         -         -         *         -         -         -         -:140
query           KSGEIKGLDFSENMLSVGEQKVKDGGFSQIELLHGNAMELPFDDDTFDYVTIGFGLRNVPDYLTVLKEMR
00450601   1/1  slalaer.ga..eVtgvDiseemlelAreraaengldpgadnvefvvgdaedlpellfpdgsfDlvvsnf
00507621   1/1  .gp..evtgvDispemlelArerakengl.nvefiqgDaedlpf.dgsfDlvvsnpnvlhhlppedlekl
00421971   1/1  elllelldelllkpgkrvLDiGCGtGylalalakl.lPgarvtgvDispemlelArera...g..nvefi
00518421   1/1  ga..evtgvDispemlevarer....g..nvefvvgdaedlpfpdgsfDlvvssfgvlhhlpdpeaalre
00401961   1/1  rvLDvGCGtGglllalakryg..arvtGiDispemlelareraaelglpnrvefvqgdaedlp..d.sfD
00473861   1/1  llgepgarvtgvDispemlelareraaelglsdnvefvvgDaedlplpd..fDlvvsnavlhhlpdpdle
00516791   1/1  alllaarlga..rvtglDlspamleearkrlaelgladdwsplvkvvcelegklllleeleellrdlvnv
00491711   1/1  a.gevtGvDiseemlelArerakeaglsdnvefivgdaedlpefpdgsfDlvvsnfvlhhlflspedlea
00478511   1/1  krvLDiGCGtGllalalakrvga..rvtgvDispemlelarenakenglpnrvefivgdaedl...dgsf
00512391   1/1  .ga..kvtgvDiseemlevArerakeagl.nvefivgdaedlpf.dgsfDlvvsnfnvlhhllseedlek
00496711   1/1  krvLDiGcGtGglalalakalg.a.rvtgvDispemlelarenaaelglpnrvefvvgDaedl...dgsf
00491221   1/1  LDlGcGtGglalalakr.ga..rvtgvDispemlelarenaaelglsdaddnvefivgDaedlplpelll
00502421   1/1  ...grvtgvDispemlelarer.......nvefvvgdaedlpfpdgsfDlvvssavlhhlpdpeallrel
00528071   1/1  ak.rvtgvDisp.mlelarenaaenglpnrvefivgDaedlplpdgsfDlvvsnplpfvlhhlpdleall
00502341   1/1  ..arvtgvDispemlelareraaelglpnvefvvgDaedlpfpdgsfDlvvsnavlhhlpdpeallrela
00490741   1/1  patrlllelllellglkpgkrvLDiGcGtGglalalakalPga.rvtgvDi.pemlelarenaaelglsp
00479191   1/1  rvLDiGcGtGglalalakalg..arvtgvDispemlelareraaelglpnrvefvvgDaedl...dgsfD
00497191   1/1  elllelllellplkpgkrvLDiGcGtGglalalakal.pgakvtgvDi.pemlelarenakelglpnrve
00473291   1/1  eafgrgtqitqpavaalllellglkpGarVLDlGcGtGaltlalaravgpggrvvavDispealelaren
00511431   1/1  ...rvtgvDispemlelareraaelglpnvefvvgDaedlpfpdgsfDlvvsnavlhhlpdpeallrela
00511031   1/1  gdllslrpaqeellelllellplkpgkrvLDiGcGtGglalalakrlga..rvtgvDispemlelarena
00414441   1/1  ..arvtgvDispemlelareraeelglpdnvefvvgDaedl.fpdgsfDlvvsngvlhhlpdpeallrel
00463541   1/1  tlalllellglkpgkrvLDiGcGtGylalalarlggpdgrvvavDispealelarenaerlgldnvefil
00468381   1/1  gserlldll.lellpllkpgkrvLDiGcGtGglalalakal.PgarvtgvDi.pemlelarer......p
00498851   1/1  rgldflvipavldprpdgerlvldpglffgtglhpttelllellakllkpgdrVLDlGcGtGtlaialak
00466961   1/1  gak.rvtgvDisp.mlelarenaaenglpnrvefivgDaedlplpdgsfDlvvsnpsgvlhhlpdeleal
00516571   1/1  laeagp..aevtgvDispemlerareraaeag.pnvrvlvgdaedllpplpdgsfDavlsDppsevlhhv
00469311   1/1  lgpk.rvtgvDisp.mlelarenaaenglpnrvefivgDaedlleplpd..fDlvvsnPpggvlhhlpdl
00525361   1/1  GtGrltlallarlga..evtgvDlseemlevarerlaeaglprvefvvgdaedlpfpdgsfDlivssevl
00468401   1/1  lllellglkpgkprvLDiGcGtGglalalakrlPga..rvtgvDi.pemlelarer......pnvefvvg
00408291   1/1  g.arvigvDispealelarenlkelg.dnvefiqgdaldlpellllfpdgsfDlilsDpPysslgllifv
00526491   1/1  llpg.akvtgvDispemlelarenakelglpnvefivgDaedlpellpdgsfDlivsnpPypwpgvlhhl
00530771   1/1  a..rvtgvDlspemlelareraaaagldnvefvvgdaedlpf.dgsfDlvvsngvlhhlppedleallae
00527091   1/1  rvLDiGCGtGglarylaeryg..arvtGiDlseemlerareraaeaglsnrvefivgdaedlp...gsfD
00509351   1/1  kpgkrvLDlGcGtGllaialaklfp.gakvtgvDispemlefarenakklgldnvefiqgdaedlpfell
00501541   1/1  .garvtgvDispemlelareraaelgl.nvefvvgDaedlpfpdgsfDlvvsnavlhhlpdedleallre
00476561   1/1  alfpsigakvtgvDiseemielakerakelglsdnvnvefivgdaeellleqlepfedekfDliisnnvl
00379821   1/1  lGcGtGgltlhlaklvgpeGkvvgvDispemlelarenleklg..nvefilgDaeelpkyllpdgsfDvi
00479231   1/1  ...kvtgvDispealelarenakelglddnvefivgDaedlplpdgsfDlivsdpplhhlpd...llkel
00514491   1/1  llpg.akvtgvDispemlelarenakelglpnvefivgdaedlpellpdgsfDlivsnpPypsgvlhhlp
00509191   1/1  laeagpe..evtgvDispemlerareraaelg.pnvrvlvgdaeellpplpdgsfDavlsDppgssevlh
00512611   1/1  gltlalarlvgpegrvtavDiseealelarenlerlglddnveviqgDaed.plpdgsfDaivs.....d
00494741   1/1  DiGcGtGglalalakllppgakvtgvDispealelarenakenglpnrvefivgdaedflpfllaeglld
00488051   1/1  lalilellglkpGdrVLDlGcGsGgltlhlaelvgpeGkVygvDispemlelarenleelg..nvefilg
00484901   1/1  dpaysdslarfgegntllqpelaelllelldlkpgkrvLDiGcGtGglalalakllgpdarvtgvDispe
00467441   1/1  qeallelllellglkpgkrvLDlGcGtGglalalakllga.grvtgvDispealelarenaa..glpnve
00446891   1/1  gkrVLDiGcGtGyltlllaklgg...kvtgvDiseemlelarenlkeng..nvefivgDaeelpfpdesf
00472111   1/1  GtGllalalaralppgarvtgvDlspealelarerlaeaglafdwspllkvvlelegnlelleeleellr
00476761   1/1  DlGcGtGllalalakllp.garvtgvDispealelarenaaelgldnvefvvgdaedlp.pdgsfDlvvs
00479451   1/1  ydsyyfeakllglyrsraalkleelleklglkpgkrvLDlGCGtGglalylakryp.gakvtgvDispem
00451091   1/1  ...kvtgvdiseemlelakenlkeng..nvtfihgDalelpfpdgkfDlivsNpPynistavlehlpdle
00495321   1/1  lllplsvlelllllellerrllgepveyllgerefyglafkvgggvftprpttelllelllellp.kpgk
00507451   1/1  selgleelealleallellppidlrvnklkisreelgepvelllgelpeelyvqflglkfkvd.pgvffr
00499151   1/1  slderqrallllllallglkpgkrvLDiGcGtGglalalakr.pegarvtgvDispealelarenlaelg
00516171   1/1  .ga..rvtgvDispemlelareraaengladnvefiqgDaedlplpd..fDlvvsnlplhhlpdleavla
00409641   1/1  nlkkgkrVLdiGcGtGglarellkh..gaaevtgvdidpevielakenlklnglsvlnagalddprvevi
00509881   1/1  rldeaqytell..lllllldlkpgkrvLDiGcGtGglalalakrgp.aakvtgvDispealelarenlke
00465681   1/1  gpggrvvavDlsp.mlelar..........vefiqgdardlplldlllellpdgsfDlvlsdaplshlgd
00445501   1/1  lkgdglglgfyekgskilvrieecpildeillellprlrellsrldeltkegllrllllrsgelllllvd
00430851   1/1  llellledlkpgarVLDiGcGsGyltlalarlvpelgkdpggrvvgvDispealelarenlerlgldlll
00486291   1/1  ak.kVtgvDisp.mlelarenaklngldnrvefiqgdaedlplpdekfDlvvsnpvlhhlpnesdlekll
00484381   1/1  LDlGcGtGglalalakllga.grvtgvDispealelarenakrlg..nvefivgDaedlldlplpdgsfD
00415931   1/1  gkdfaeiaalydlyndsyesfyqlnagqallldegmlipraltemlldlvysltvpdarklnhyisfsde
00531071   1/1  rgak.kvtgvDispealelarenaklngldednvefiqgdaldflplllldekfDlivsnppyglegled
00415801   1/1  gepleyllglyeflglefgtgpgvfiprpttelllelllellglkpgkrvLDlGcGsGllaialak.lga
00403271   1/1  ralsellldellealpdlsggkrvLDvGcGtGalllalakkyPga.kvtgvDlsp.mlelaren......
00518231   1/1  vdrygdwlvvlllealgeeeleelleallellpelrvnllkisredlleelldelielllgerdllgely
00519301   1/1  lavdrypdwlvvlllsalgeeelealleallellpdlrvnllkisreeklllrreeilpllpetlleefl
00474711   1/1  iydlgndgrvllldglvlgsrpdeaqerllllllallplkpgkrvLDiGcGtGglalalakrgp.darvt
00505191   1/1  ..grvigvDidpealalarerlaglgllnrvefvqgdalalplpdgsfDgvlldlglsslgldradndel
00518841   1/1  khddligklygsfldsskgysvallrpapedltlllkrgtqivqpkdialilelldlkpGdrVLDiGtGs
00518851   1/1  nldllplgegqyieelwpglalslkvdevlhekkskyqiiriydlgndgrrlfldggvqysrlderqlee
00521821   1/1  diGtGtGysalalaralppgarvvavdispealalarenleaaGledrvtvilgdaedllpqllaplpdg
00474651   1/1  llelleklgvvleaydllgdpleyllglrefyslplfkdglvltqd..avsellvelldpkpgdrVLDlG
00475801   1/1  llalllelldlkpgdrvLDiGcGtGylalalaklvg..grvtavdispealelarenaerlgldnvevil
00528941   1/1  pdvrvvgvDiseealekarqrlganpl.niefivgdalqlplpgg.fDlilsnfvlehledprkllrela
00518401   1/1  GtGllllalaellppgaevtgiDidpdalevarknlkrlglpkrvrlvvgdaldalpalaegvedgkfDl
00426821   1/1  ...kvtaieideemlelakenlkelg..nvefiqgDalklpfpdgkfDlivsNpPynissavlhhledle
00366101   1/1  aialakrga...kvtgvDispealelakenaklngldnrkvefiqgdaed.plpdgkfDlivsnppyllg
00497781   1/1  ilkllspglgeayilglwkskdltdpigdikrlieilyelylslevlskllelilhflnrnteegdleni
00519441   1/1  lrvnellaelgielerdelgppllyllggvefadlplyktgvfitqdeasallaelldlkpgdrVLDlga
00526181   1/1  ydilgelyeyllgefaglrfklgefytprpvtellvelllpklgdlkglrvLDpgCGsGgllialakrlp
00390931   1/1  erleliyhealahllllllkppkrvLdiGgGtGglarellkh.gpvakvtgvdidpevielarenfklng
00478621   1/1  lvddlnpgekvLdvGcGsGlllallaeaigvagkvlgvDidaevldlaednlkknglsllssgnvelvvg
00494421   1/1  llpllplayilgerlefallpgfktglfltqr..evsellaelldlkpgerVLDlgcGtGgltlalaklv
00413261   1/1  l.Ga.akvtavDispealelarena...g..nvefivgdaeelp...gkfDlivsNPPyvplsdilllev
00487741   1/1  ga..rvigvDispealeqarenaelnglvsevgdllvysadnvefivgDafdlppadlgsvdlvldraal
00532291   1/1  lyeekspyqeivvvesgdfgrllfldgvvqsterdefiyhemlahlllllhpnpkrvLdiGgGtGglare
00507491   1/1  r..gakkvvavDidpealelarenaelngl.nveviqgdalelp...gkfDlvvsNPPyiitskillkll
00520011   1/1  lpedgallrlllaelkpkriLElGcgtGgsllllaealkllgpdgkvvgiDispemlevar.....glld
00490691   1/1  g...akvtavEidpdllellkerlkelg..nvevingdalkldlpdlllelekfdlvvsnlpynistdil
00531101   1/1  dalevkgiylkvnrrllglplrvllgelpetitveenglkflvdpgsffqtglrpdtrllrealaaalag
00473031   1/1  tGaltlaLlkrlgak.kvtavEidpdmieilkerlk..g.pnvevingDaldldelllllpddf....vs
00350261   1/1  ealalagpgarvtatDispealekareglyplgllrglplellkryflkllgadgglyrvkpelrdrvef
00520841   1/1  lpkggrvLdlGCGtGrdalwLaer.Gf..dVtGvDisetalelareraklaglvtrlgeleggklflysg
00525101   1/1  gar.kvyavDlsplalelcrknlallglddrvkvvhgdlldlldleessfDlilldppysllilelldvl
00530871   1/1  pgarvvgvDidpealelaren.........eivvgDalellp.desfDliiaNPPyggsgdldrlldell
00529821   1/1  ........ilemlqelkglsvldiGcGtGtlailllrl.gparrvvavDispevvelakkrlqalglenr
00485241   1/1  llieaa.laarrpaarviGvDidpaalelArrnlallgladllllesasellsslleklslldlllaldl
00527391   1/1  sGalgleaasr..gaarvtaveispealelarenaallgldnveviqgdaleflpelgekfdliflDPPy
00506931   1/1  ga...evvavDidpeavalarenaerlglenrveviqgdafellaalpgesfDlvvldPPygldglelll
00527491   1/1  evlaGedletevkengikfkldpgkfyfsnglrperlrvlel....lkpgetVlDlgaGiGilalpaakl
00491861   1/1  lrllagellklldrdfpginrgy.aaRtrfiddlvrrflaegpraqvldLGcGldtrafrlaerppga.r
00526931   1/1  lfnilapllegkrvLDlfaGsGalgleaas..rgaakvvavdispealelakenaalnglenrvevirgd
00432761   1/1  Ga..kVvavdiseeklelake...lGadfvvvykdedvaeavleltg.gadvvidtagipg......ilr
00383791   1/1  elkpgsrVlviGaGgvGsaaaqllaaaGv.gkvilvDrdeealerarrlgpdvvvdpiedlaeallellg
00369761   1/1  ...rvigvdldpeavelarerlerngvk.ievllgda..ldlldgsfdlvva------------------


                         +         -         -         -         -         *         -:210
query           RVVKPGGQVVCLETSQPEMFGFRQAYFMYFKYIMPFFGKLFAKSYKEYSWLQESARDFPGMKELAGLFEE
00450601   1/1  gvlhhlPpyfldpedleaalrelarvLkpGGrlvlstpnredlallralleaylrdllpelgglvvsdvl
00507621   1/1  lrelarvLkPGGrlvlstpnpegleellalllallllelvllvdllpetdrlekvvllelllllkgdlev
00421971   1/1  vgdaedlpfpdgsfDlvvssfvlhhl.d......elarvLkPGGrlilstpnppyleelrellekllrll
00518421   1/1  larvLkPGGrlvlstpnreslpelrelllaylllkllfpelg.........yrlldpshlrflspeella
00401961   1/1  lvvsnevlhhlgpedleaalkelarvLkpGGrlvlstinledlee........lrealeflgllprrlhd
00473861   1/1  allrelarvLkpGGrlvlsepnlpdleellelllelllellpllglllleierllell.ephlrfltlee
00516791   1/1  elvvgdaedlplpdellgsfDlvvssfvlehvceglddlraalaelarvLkPGGrlvlstilrlplylvg
00491711   1/1  alreiarvLkPGGrlvlstpnpddllellellrflerlylllfglleplllllgaryifplgdgvdpvhe
00478511   1/1  DlvvsngvlehllleggldglpdpekalkelarvLkpGGrlvistpnredlsellalllkllleveellp
00512391   1/1  alkeiarvLkpgGvlvistlnpedlpellaileleellglvprilkyifeggllpsllelllalgglver
00496711   1/1  DlvvsnavlhhlpvedpeallrelarvLkPGGrlvlsepnrpdleelrllglllgeellelldlllrgi.
00491221   1/1  edgsfDlvvsnfavlhhlptgrrdpedleallrelarvLkPGGrlvlstpnpddleellellldlgllvl
00502421   1/1  arvLkPGGrlvlsepnrpsleelllllllllllllp...................hgrflsleeleelle
00528071   1/1  reaarvLkPGGrlvlstpsppgleellellralllekllfvggfdledlvelgflevevlrldyartlee
00502341   1/1  rvLkPGGrlvlstpnlpdlellrlllalllrll..................dppggrfrspeeleellee
00490741   1/1  nvefvvgDaed.plpd.sfDlvvsngvlhhlpdpdleallrelarvLkpGGrlvlsepvrpdleellell
00479191   1/1  lvvsnavlhhlpledleallrelarvLkPGGrlvlstpnrdgleellelllllllellelldlllkeipp
00497191   1/1  fivgDaed.plpdg.fDlivssgvlhhlpdpelekllkelarvLkpGGrlvisepnrpdesylrellgll
00473291   1/1  laraglalpdnvevvvgDaedlplpdgsfDavvs.....dlpdpeaalaeaarlLkpGGrlvlseptleq
00511431   1/1  rvLkPGGrlvlstpnrpdleelrelldllerlllpgh..................grflsleeleallee
00511031   1/1  aelgl..vefivgDaedlpfpdgsfDlvvsngvlhhlpdpelkkllkelarvLkpGGrlvistpnrdd..
00414441   1/1  arvLkpGGrlvlseptlege.....................epeelldfilryifpggflsleellalle
00463541   1/1  gdaedllfedgsfDlvvsdapleh......lleellrlLkpGGrlvlstilleg................
00468381   1/1  nvefvvgDaed.plp..sfDlvvsngvlhhlpdpeleallrelarvLkPGGrlvlsepvrpdleelrlll
00498851   1/1  l.ga..rvtgvDispealelArenaarngldnvefvqgdaedlp..dgsfDlvvsnpplehlpd...lla
00466961   1/1  lrelarvLkPGGrlvlstps...ppllpeelelllkel--------------------------------
00516571   1/1  rrpdpeaflreaarvLkPGGvlvlstlllaglelerdaeh............................vr
00469311   1/1  eallrelarvLkPGGrlvlstpnrpglpellelllaelleifpgvggfdlsellellleeagfegvdyer
00525361   1/1  hhlsdedlaaflrelrrvLkPgGllvisdpvlpd............................dlrlddlp
00468401   1/1  Daed.plp..sfDlvvsngvlhhlpdpeleallrelarvLkpGgelGrlllsepvrpdlpelrlllllel
00408291   1/1  lhhledleefleealrvLkpgGrlvlvtfssledeivkkllkelgklvlvvkgpl...............
00526491   1/1  pdellekllkelarvLkpGGrlvlst...........pnrdyleellellkalgfllllifpgldlpvlr
00530771   1/1  larvLkpGGrlllstpnrldl.............................rkglppplrllsleellell
00527091   1/1  lvvsievlehvgpedleaflkelarvLkpgGrlvlsdpnrpdllel........eelllllpretlrlgd
00509351   1/1  ldgsfDlivs....rhvadlekllkeaarlLkpgGrlvlsdgssyleeleelekalkllgfkllevi.kl
00501541   1/1  larvLkPGGrlvlstpnrp.......................................dllsleeleell
00476561   1/1  hhvpdleaalkelyrlLkpgGklliiepsg..dslleklf...................gelpklidgrp
00379821   1/1  lsdaplshlpde..aleealrvLkpGGrlvisdfsr----------------------------------
00479231   1/1  lrlLkpGGrlvlstpnpegleellellkklgfl-------------------------------------
00514491   1/1  dpllqeellkelarvLkpGGrlvlst...........pnldyleellellkalgflvlliepglllpilk
00509191   1/1  hvpdleaflaeaarlLkPGGvlvistll............gwdeeledll................evvr
00512611   1/1  lpdpwelleelarlLkpGGrlvlstptieq........................................
00494741   1/1  gsfDlivsdalh...pdlpklleelarlLkpGGrlvlsdplrpgeevllell------------------
00488051   1/1  DaeellklpfpdgsfDvvlsdavlh..pdpeaaleealrvLkpGGrlvisdftreq..............
00484901   1/1  alelArenakrlglddnvefivgDaed.plpdgsfDlivs.....dppdpeelleellrlLkpGGrlvls
00467441   1/1  fivgDae.dplpdlleegsfDlvvsd..lphvpdpealleeaarlLkpGGrlvlstpsrteeeleelleg
00446891   1/1  Dlivsnaplhhl......leellrlLkpgGrlvlvdgnpeg..........elldkllkllllllkeelf
00472111   1/1  adrvrfvvgdaedlppllalplpdgsfDavvssfvlhhvppdlpdleralrelarlLrPGGrlllveplr
00476761   1/1  ....nppydlealleelarlLkpgGrlvlstgsrlleeleell---------------------------
00479451   1/1  lelaren.krlgldnvefiqgvda..lpfpdgkfDlvvsDppfsgvlhhvpdpellel------------
00451091   1/1  elrrlvlmlqleealrlLkpgGrlvlvvgtledveillkvppgaffpppkvdsavvrltrrespllleil
00495321   1/1  rvLDlGcGtGglalalakllpga.rvtgvDispealelarenaalngldnvefvqgDald.plpdgsfDl
00507451   1/1  pgte.llvelllelldlkpgkrvLDlGcGtGglalala--------------------------------
00499151   1/1  lgllddpnvefivgDaedflpfldgsfDlivsdpplhhlpdpeldrLlqeeflreaarlLkPGGrlvlst
00516171   1/1  elarvLkpgGrlvlsevaerlvappgdklygrlsvllqllydvel-------------------------
00409641   1/1  vgDalellfedekfDviiaDlpdsiglphlldleeflrelyrvLkpgGvlvvnslspdellellkellkt
00509881   1/1  lglslddpnvefivgDaedllkplpdgsfDliisdpp---------------------------------
00465681   1/1  lrrdlarlaalqlalleealrlLkpgGrlvlstcseeneevllallkkyfdlvllvk-------------
00445501   1/1  kpldedveealkalyd------------------------------------------------------
00430851   1/1  pdnvefivgdaedlpfpdgsfDlvvsnavlhhl......leellrlLkpGGrlvlsvpnregleellell
00486291   1/1  kelkrlLkpgGrlilsditlylapiedeelllervlfwpdvygfdl.......................d
00484381   1/1  lvvsd..lphlpdpeallreaarlLkpGGrlvlstpsreeeellelllll......eellel--------
00415931   1/1  vygetspelvaelldlldlkpgdvvlDiGcGtG-------------------------------------
00531071   1/1  lekllkea.rlLkpgGilvl.einpetleellellkelglk-----------------------------
00415801   1/1  .akvtgvDispealelArenaelnglsnrvefivgdaleflpfpdgkfDlivsNPPygglsellievlhh
00403271   1/1  prvefvvgDafd.plp..sfDlivsswvlhhlpdeelvkllkeayraLkpgGrliivepvlpdlgelplt
00518231   1/1  englrflvdpdgfgtglfptqe------------------------------------------------
00519301   1/1  glrfkvdpgvffqtglfptqel------------------------------------------------
00474711   1/1  gvDispealelarenlalnglelglpnvefivgDaedflpfldgsfDlivsdpplhhlp-----------
00505191   1/1  edlaealeeaarvLkpGGrlvvitfhsledrivkrfflelffklltrkpilpseeeielnpr--------
00518841   1/1  GgltlllarlvgpkG-------------------------------------------------------
00518851   1/1  lllllalldlkpgkrvLDlGcGtGglalalakrgp.d---------------------------------
00521821   1/1  kfDlifldaplehlpdllell.ealrlLkpGGvlv-----------------------------------
00474651   1/1  cGsGglalalaklvgpagrvvavDispealelarenakrlgldnveviqgDaldlpledgkfDlilsdpP
00475801   1/1  gdaeellfedgsfDlvvsdaplph......lleellrlLkpGGrlvlvvgtleg................
00528941   1/1  rvLkpgGrlvlvt....pnlespepsnvlddlllslflslgesflldiekldddirfllsvdelkrllee
00518401   1/1  iildfvlehlad...llkqvlrlLkpgGvlviadylrpgllkllalles---------------------
00426821   1/1  karrltlmlqleealrlLkpgGrlvilvqnltlvelllkvpkeafvPpPkvdsavvrlepkgipllpkde
00366101   1/1  ledleklleeaarlLkpgGilllstnprt.........................................
00497781   1/1  lahydlgndllkrlipd-----------------------------------------------------
00519441   1/1  GsGgltlalaelvgpggrvvavDispealelar-------------------------------------
00526181   1/1  naggaevtllGvDis-------------------------------------------------------
00390931   1/1  lalddprvevivgDaleflkeldekfDviilDlpdpilgplehlyteeflkecyrvLkpgGvlvvntisp
00478621   1/1  dllkliledgkfDvvlsdpplehi......leeiarlLkPGGklvlvtpdin..................
00494421   1/1  gaag.vvavDispealelarenaelngl.nve--------------------------------------
00413261   1/1  ldleplsallehlddleelleeaarlLkpgGrlvlstplptq............................
00487741   1/1  halppedrerylrellrllkpggrlllvtleypqallagppfsvseee----------------------
00532291   1/1  llkhlp.vekvtavEidpevielarkyfpllglalddprvevvvgDaleflkeldekfDvIildlpdpdg
00507491   1/1  lklepelaldvledlldleelleaaarlLkpgGrlvl...vipsrflp----------------------
00520011   1/1  nvtliqgdaldlpflekllelgsfDlvfidashshypvlldl...llrlLkpGGvlvvddvlppg-----
00490691   1/1  lkllellrllkpg---------------------------------------------------------
00531101   1/1  lakgkrvLDlgcGt--------------------------------------------------------
00473031   1/1  nlvlhhlpdpekl---------------------------------------------------------
00350261   1/1  lqgdlldlpppldgsfDlifcrnvliyfddelqer-----------------------------------
00520841   1/1  pnitfvqgdlfdlpf-------------------------------------------------------
00525101   1/1  lsaa.rvLkpgGlvvv------------------------------------------------------
00530871   1/1  krlydelalalsgvlglldlyrafleealrlLkpgGrlvfvtpnsf------------------------
00529821   1/1  vtfilgdaldilrdllellsdgsfDvvvldPPfisslpllalgvlehlpdpdaa----------------
00485241   1/1  leelllgelkt-----------------------------------------------------------
00527391   1/1  aggll...dll-----------------------------------------------------------
00506931   1/1  lllaa..rllkpggllvlehglelllpllllrryglt---------------------------------
00527491   1/1  ..gakkVvaveidpeavellreNaklnglenrvevingda------------------------------
00491861   1/1  vvevDl.pevlalkrallaeagalpgllglllldlsllslllssdrvrfvaaDlrdldwldalleagfDp
00526931   1/1  alellkallkegekfDlvvlDPPyfa..glllyllllllalkll--------------------------
00432761   1/1  eilrllkpggvivllgl-----------------------------------------------------
00383791   1/1  g.rgvDlvldc-----------------------------------------------------------
00369761   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           AGLKNVKYHSFTGGVAATHIGWK-----------------------------------------------
00450601   1/1  ylrllgesvlleallkllpaggl-----------------------------------------------
00507621   1/1  vrllleslplrlltl-------------------------------------------------------
00421971   1/1  epllalvygfdglkv-------------------------------------------------------
00518421   1/1  lleeaGfevveveeltlplallll----------------------------------------------
00401961   1/1  fikryifpggrlptpeeleelle-----------------------------------------------
00473861   1/1  lrelleeaGFevvevepltggla-----------------------------------------------
00516791   1/1  glgfpgg................-----------------------------------------------
00491711   1/1  rllsleelealleeaGfevveve-----------------------------------------------
00478511   1/1  flykydfp...........hgrfl----------------------------------------------
00512391   1/1  lgesvrlrfltleel-------------------------------------------------------
00496711   1/1  .......epggrlltleelrell-----------------------------------------------
00491221   1/1  pelgrlvaldll----------------------------------------------------------
00502421   1/1  eaGfevveveelplgpllllrll-----------------------------------------------
00528071   1/1  plelfgfd--------------------------------------------------------------
00502341   1/1  aGfevveveelplplaltlllk------------------------------------------------
00490741   1/1  gllldlllyifpg.........------------------------------------------------
00479191   1/1  gg........rfltleelealle-----------------------------------------------
00497191   1/1  dllll.................ifp---------------------------------------------
00473291   1/1  laellellraaglfvl------------------------------------------------------
00511431   1/1  aGfevveveelplpl-------------------------------------------------------
00511031   1/1  ........................----------------------------------------------
00414441   1/1  eaGfevvevedltag-------------------------------------------------------
00463541   1/1  .......................-----------------------------------------------
00468381   1/1  llrllldllllifpg........-----------------------------------------------
00498851   1/1  eaarlLkpGGrlvlveinpe--------------------------------------------------
00466961   1/1  ----------------------------------------------------------------------
00516571   1/1  fvtpeelealleeaGfevveierl----------------------------------------------
00469311   1/1  llepplel--------------------------------------------------------------
00525361   1/1  ggrfrtpeelrelleeaGfevv------------------------------------------------
00468401   1/1  lfdllllfpggrl..........-----------------------------------------------
00408291   1/1  ..lpslee--------------------------------------------------------------
00526491   1/1  flsltelekll-----------------------------------------------------------
00530771   1/1  eeaGfevveveeltlgllltlll-----------------------------------------------
00527091   1/1  fikkyifpggrlptleellell------------------------------------------------
00509351   1/1  ilpllda---------------------------------------------------------------
00501541   1/1  eragftgvrlls----------------------------------------------------------
00476561   1/1  ggrflslee-------------------------------------------------------------
00379821   1/1  ----------------------------------------------------------------------
00479231   1/1  ----------------------------------------------------------------------
00514491   1/1  flslteleklle----------------------------------------------------------
00509191   1/1  lvseeelealleeaGfelveve------------------------------------------------
00512611   1/1  ..leellelleeaGfevveveel-----------------------------------------------
00494741   1/1  ----------------------------------------------------------------------
00488051   1/1  ...........-----------------------------------------------------------
00484901   1/1  epspedle--------------------------------------------------------------
00467441   1/1  f.............--------------------------------------------------------
00446891   1/1  evdfvpltdrf-----------------------------------------------------------
00472111   1/1  ls.dyivgdgr-----------------------------------------------------------
00476761   1/1  ----------------------------------------------------------------------
00479451   1/1  ----------------------------------------------------------------------
00451091   1/1  tlelrfvf--------------------------------------------------------------
00495321   1/1  ivsNPPysgsgvlhhlpdevr-------------------------------------------------
00507451   1/1  ----------------------------------------------------------------------
00499151   1/1  psppdgrlell-----------------------------------------------------------
00516171   1/1  ----------------------------------------------------------------------
00409641   1/1  lrkvfpdvelyvak--------------------------------------------------------
00509881   1/1  ----------------------------------------------------------------------
00465681   1/1  ----------------------------------------------------------------------
00445501   1/1  ----------------------------------------------------------------------
00430851   1/1  relgf.----------------------------------------------------------------
00486291   1/1  llekagfevvrv----------------------------------------------------------
00484381   1/1  ----------------------------------------------------------------------
00415931   1/1  ----------------------------------------------------------------------
00531071   1/1  ----------------------------------------------------------------------
00415801   1/1  lpdlaldggkdg----------------------------------------------------------
00403271   1/1  ellallldllmlvltdggr...------------------------------------------------
00518231   1/1  ----------------------------------------------------------------------
00519301   1/1  ----------------------------------------------------------------------
00474711   1/1  ----------------------------------------------------------------------
00505191   1/1  ----------------------------------------------------------------------
00518841   1/1  ----------------------------------------------------------------------
00518851   1/1  ----------------------------------------------------------------------
00521821   1/1  ----------------------------------------------------------------------
00474651   1/1  ysglg-----------------------------------------------------------------
00475801   1/1  ........................----------------------------------------------
00528941   1/1  aGfeivevresgvpifvsdvle------------------------------------------------
00518401   1/1  ----------------------------------------------------------------------
00426821   1/1  ellerlvka-------------------------------------------------------------
00366101   1/1  .laeellelleeagfeveevkd------------------------------------------------
00497781   1/1  ----------------------------------------------------------------------
00519441   1/1  ----------------------------------------------------------------------
00526181   1/1  ----------------------------------------------------------------------
00390931   1/1  lldlellkelletlkevfpkvlpv----------------------------------------------
00478621   1/1  ........................----------------------------------------------
00494421   1/1  ----------------------------------------------------------------------
00413261   1/1  .........-------------------------------------------------------------
00487741   1/1  ----------------------------------------------------------------------
00532291   1/1  pdealyteefleelk-------------------------------------------------------
00507491   1/1  ----------------------------------------------------------------------
00520011   1/1  ----------------------------------------------------------------------
00490691   1/1  ----------------------------------------------------------------------
00531101   1/1  ----------------------------------------------------------------------
00473031   1/1  ----------------------------------------------------------------------
00350261   1/1  ----------------------------------------------------------------------
00520841   1/1  ----------------------------------------------------------------------
00525101   1/1  ----------------------------------------------------------------------
00530871   1/1  ----------------------------------------------------------------------
00529821   1/1  ----------------------------------------------------------------------
00485241   1/1  ----------------------------------------------------------------------
00527391   1/1  ----------------------------------------------------------------------
00506931   1/1  ----------------------------------------------------------------------
00527491   1/1  ----------------------------------------------------------------------
00491861   1/1  drptlvla--------------------------------------------------------------
00526931   1/1  ----------------------------------------------------------------------
00432761   1/1  ----------------------------------------------------------------------
00383791   1/1  ----------------------------------------------------------------------
00369761   1/1  ----------------------------------------------------------------------