[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for bsub0:CAB15681.1


[Show Plain Result]

## Summary of Sequence Search
   1::569
 132::569   1e-193 69.2% 0045611 00456111 1/1   lo-dependent hydrolases                 
 133::569   3e-190 70.2% 0036862 00368621 1/1   lo-dependent hydrolases                 
 133::569 8.3e-179 67.3% 0046571 00465711 1/1   lo-dependent hydrolases                 
   2::182  3.4e-66 55.3% 0046499 00464991 1/2   site domain of metallo-dependent hydrol 
   1::477  4.2e-61 54.4% 0037043 00370431 1/1   site domain of metallo-dependent hydrol 
   1::131  1.3e-53 58.8% 0053352 00533521 1/2   site domain of metallo-dependent hydrol 
 132::433  3.2e-42 28.7% 0039934 00399341 1/1   lo-dependent hydrolases                 
 132::354    6e-32 30.3% 0053093 00530931 1/1   lo-dependent hydrolases                 
 132::425  3.9e-30 24.4% 0052789 00527891 1/1   lo-dependent hydrolases                 
 132::424  3.7e-21 22.3% 0047006 00470061 1/1   lo-dependent hydrolases                 
 132::422  5.1e-21 21.5% 0051086 00510861 1/1   lo-dependent hydrolases                 
 275::482  1.6e-13 42.0% 0053352 00533522 2/2   site domain of metallo-dependent hydrol 
  66::439  4.9e-13 38.6% 0047005 00470051 1/1   site domain of metallo-dependent hydrol 
  60::459  1.7e-12 35.8% 0041948 00419481 1/1   site domain of metallo-dependent hydrol 
  67::456  5.4e-12 36.9% 0044456 00444561 1/1   site domain of metallo-dependent hydrol 
  68::439  1.1e-10 40.3% 0047004 00470041 1/1   site domain of metallo-dependent hydrol 
  66::458  3.1e-10 31.8% 0053092 00530921 1/1   site domain of metallo-dependent hydrol 
 132::276  3.3e-09 31.7% 0047785 00477851 1/2   lo-dependent hydrolases                 
  67::439    3e-08 46.2% 0047518 00475181 1/1   site domain of metallo-dependent hydrol 
 432::480    7e-07 53.1% 0046499 00464992 2/2   site domain of metallo-dependent hydrol 
  69::145  1.2e-06 35.4% 0040031 00400311 1/1   site domain of metallo-dependent hydrol 
 132::425  1.7e-06 22.6% 0052760 00527601 1/1   lo-dependent hydrolases                 
  86::432  2.5e-06 25.7% 0045709 00457091 1/1   lo-dependent hydrolases                 
  86::436  8.2e-06 26.8% 0047865 00478651 1/1   lo-dependent hydrolases                 
  66::131  9.6e-06 41.5% 0040833 00408331 1/1   site domain of metallo-dependent hydrol 
 133::250  0.00032 26.1% 0038137 00381371 1/1   lo-dependent hydrolases                 
 404::425        5 31.8% 0047785 00477852 2/2   lo-dependent hydrolases                 
   1::569


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKMSREEYAELFGPTTGDKIRLGDTDLWIEVEKDFTVYGEEMIFGGGKTIRDGMGQNGRITGKDGALDLV
00456111   1/1  ----------------------------------------------------------------------
00368621   1/1  ----------------------------------------------------------------------
00465711   1/1  ----------------------------------------------------------------------
00464991   1/2  -lkkisreeyaelyGPttGdkvrlgdtdliieveedltvyGeevkfGGGktlrdglgqat..trseeald
00370431   1/1  mkisrlayadllgpttgdlvrladtdllaevekdltlygeelvfgggkvlrdgmgls..vaaademadll
00533521   1/2  lkisrkeyaelygPttgdgvrladtdlvaevekdrttyGeevlfgGGktlreGlgqgksltraegaldll
00399341   1/1  ----------------------------------------------------------------------
00530931   1/1  ----------------------------------------------------------------------
00527891   1/1  ----------------------------------------------------------------------
00470061   1/1  ----------------------------------------------------------------------
00510861   1/1  ----------------------------------------------------------------------
00533522   2/2  ----------------------------------------------------------------------
00470051   1/1  -----------------------------------------------------------------mmdll
00419481   1/1  -----------------------------------------------------------vaaleesmlll
00444561   1/1  ------------------------------------------------------------------mdll
00470041   1/1  -------------------------------------------------------------------dll
00530921   1/1  -----------------------------------------------------------------mfdll
00477851   1/2  ----------------------------------------------------------------------
00475181   1/1  ------------------------------------------------------------------ldll
00464992   2/2  ----------------------------------------------------------------------
00400311   1/1  --------------------------------------------------------------------gr
00527601   1/1  ----------------------------------------------------------------------
00457091   1/1  ----------------------------------------------------------------------
00478651   1/1  ----------------------------------------------------------------------
00408331   1/1  -----------------------------------------------------------------mldll
00381371   1/1  ----------------------------------------------------------------------
00477852   2/2  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           ITNVVLLDYTGIVKADVGVKDGRIVGVGKSGNPDIMDGVDPHMVIGAGTEVISGEGKILTAGGVDTHIHF
00456111   1/1  -------------------------------------------------------------Ggidthvhf
00368621   1/1  --------------------------------------------------------------giDtHvHf
00465711   1/1  --------------------------------------------------------------GiDaHvHf
00464991   1/2  lvitnalivdytGiykadiGikdgkivgiGkaGnpdvadgvkpdllvgpatdvlagegliltaggadlvv
00370431   1/1  iknarivdgdgivkadiaikdGrIaaigkalepplldgv..dlivgsateviDaeGkivtPG........
00533521   1/2  iknalivdatgiykaDiGikdGkivaiGkagnpdirdgvnpalivglypekgtievgsdta---------
00399341   1/1  -------------------------------------------------------------gfvdlHvHl
00530931   1/1  -------------------------------------------------------------GlIDtHvHl
00527891   1/1  -------------------------------------------------------------GlIDtHvHl
00470061   1/1  -------------------------------------------------------------GliDtHvHl
00510861   1/1  -------------------------------------------------------------GliDlHvHl
00533522   2/2  ----------------------------------------------------------------------
00470051   1/1  ikngrvvdpdgllvadvliedgkIaaigedlsa............peaaevidasgllvlP.........
00419481   1/1  lkngrvvdpgvlvkadvliadgkIaaigsnipadl..........lpgaevidasGklvlP.........
00444561   1/1  iknarivtpdgviedgdvliedgkIaaigegllll...........laaaevidaegllvlP........
00470041   1/1  ikngtvvdpdgllvadvliedgkIaaigenlea............pegaeviDatGllvlPGl.......
00530921   1/1  ikngtvvdg...lvadiaikdgkIaaigslle.............asaaevidasGlllvlPG.......
00477851   1/2  -------------------------------------------------------------PGlIDtHvH
00475181   1/1  iknalvltldddlledgdvlieggrIaavg................klpaaevidasgklvmP.......
00464992   2/2  ----------------------------------------------------------------------
00400311   1/1  lliknakivdgdgsfladvliedGlikaige............nlllPaglevidakgklvlliavgsda
00527601   1/1  -------------------------------------------------------------PGliDsHvH
00457091   1/1  ---------------tdflknPKvelhlhldgslspetllelaiengiil...............plgtl
00478651   1/1  ---------------tdiknlPKvelhlhldgslspetllelaikngiil...............plgtl
00408331   1/1  ikngtvvdgtgglllaadvliedgrIvavgdllal.............saaevidasGllv---------
00381371   1/1  --------------------------------------------------------------iiDvHvHl
00477852   2/2  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           ICPQQMEVALSSGVTTLLGGGTGPATGSKATTCTSGAWYMARMLEAAEEFPINVGFLGKGNASDKAPLIE
00456111   1/1  isPqqveealasGvttliGggtGPaeGtnattvtpgpwnlkrmlealdalplnlGflgkGnasspealle
00368621   1/1  isPqqveealasGittllGggtGpatgtlattvtpGalnlrrmlealdalPlnlgllGkGnaslleplle
00465711   1/1  iePgqveealatGittlagGGtgpvmglnattltpgvlnlarmleAaeglpvnvgflgkgnasnleeLle
00464991   1/2  wllalsgvkpnliikggfialsqlgdaggsiptplppgprel----------------------------
00370431   1/1  ......................................................................
00533521   1/2  ----------------------------------------------------------------------
00399341   1/1  dktltlglrlplalgtllealaltaelkklltaedlleraeqllelalasGvtai.........rthvdi
00530931   1/1  iepfletleevleaalaaGVttvvdagg............tglenfeamlelaekyplrvlaflnisvvg
00527891   1/1  depglgdgefledlesgtaaaaagGvttvvvmpntvpgtdtldglleslelrllalaeekvyvdvglhpg
00470061   1/1  repglthkledlesgtraaaagGvttvvdmpntlppidtlealaaklerakaavgvdpgfhggltgenle
00510861   1/1  repglehkedlesgtraaaagGvttvidmp.......ntippvtglealeaylelaeekslvdylftggl
00533522   2/2  ----------------------------------------------------------------------
00470051   1/1  ......................................................................
00419481   1/1  ......................................................................
00444561   1/1  ......................................................................
00470041   1/1  ......................................................................
00530921   1/1  ......................................................................
00477851   1/2  lrepllglefkedlesgtraaaagGvttvv...dmpntvppittlealeayleraee...aapvnvgplg
00475181   1/1  ......................................................................
00464992   2/2  ----------------------------------------------------------------------
00400311   1/1  dlviv-----------------------------------------------------------------
00527601   1/1  lrepflglelkedlesgtraaaagGvttvvdmpntlppi.........dtleallalleraeealyvdvg
00457091   1/1  eelaevidasgklvlpgfidahthl..dqvltggaedlarltkevledwledgvvylElrlspeelalla
00478651   1/1  eelaevidasgklvlpgfidaHthldqtllrgledladltyevledwledgvlylElrfspedvalsaal
00408331   1/1  ----------------------------------------------------------------------
00381371   1/1  rdpgllaetvetlarlleaalaaGfgravvm...Pnleppvtnleaalayraralgaapcdvgplmtltl
00477852   2/2  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           QVEAGAIGLKLHEDWGTTPSAIKTCMEVVDEADIQVAIHTDTINEAGFLENTLDAIGDRVIHTYHIEGAG
00456111   1/1  qveaGalGlklhedwGatpaaidaalsvadeydvqvaihtdtlnesgfvedtlaalkgrtihtyhteGaG
00368621   1/1  qieaGalGlklhedwGatpaaidnalsvadeldvqvaihtdtlneagfvedtlaalkgrtihtyhtegaG
00465711   1/1  lieaGalGlKlhedwgatpaaideaLavadeldvqvalHadtlnesgfvedtleaikgrtihayhtegag
00464991   1/2  ----------------------------------------------------------------------
00370431   1/1  ......................................................................
00533521   1/2  ----------------------------------------------------------------------
00399341   1/1  dtvgleglkallelleelkgrldlqivafpqlgilsledalelleealalgadlvgglppseedrsttee
00530931   1/1  lhpldflgdgdeltleelaelikvvaigeiGLklfmdysavieaqkevleaalelakelkdlpvvvHvrd
00527891   1/1  ltplrllvmgdrgetleelrelaeaiGaiGlklyltysglgvqdeelrrllelaaelglpvivHaedadl
00470061   1/1  elaelaeagvvgikefgldstnddlgvlqlevlrralelakelglplivHaededlidelleglknegil
00510861   1/1  tpglaleelaelvalgvaglklfmdggllvvddevlrralelakelglpvlvHaedpdlieglleegvts
00533522   2/2  ----------------------------------------------------------------kivaiG
00470051   1/1  ......................................................................
00419481   1/1  ......................................................................
00444561   1/1  ......................................................................
00470041   1/1  ......................................................................
00530921   1/1  ......................................................................
00477851   1/2  gltllegenleelaelakeaGaiglklymtdsglgvvddellrealelaaelglpvlvhaededli----
00475181   1/1  ......................................................................
00464992   2/2  ----------------------------------------------------------------------
00400311   1/1  ----------------------------------------------------------------------
00527601   1/1  fhpgltglngeeleelrellkaaGaiglklyltysdlgvaddeelrellelaaelglpvivHaededlid
00457091   1/1  llalldellssGtttvrdvdgig................dalaeaaeelgirarlifcilrllpeearet
00478651   1/1  alllellrsgv........ttvedvsgigdalaeaaeelgirarlilgilrhlp.eealellelalklga
00408331   1/1  ----------------------------------------------------------------------
00381371   1/1  ddettleelreavkaGvvGlklyptysslgvvddeklypv------------------------------
00477852   2/2  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           GGHAPDIMKLASYANILPSSTTPTIPYTVNTMDEHLDMMMVCHHLDAKVPEDVAFSHSRIRAATIAAEDI
00456111   1/1  GGhaPdiikvaglanvlpsstnPtrPytvntldehldmlmvchhldpsipedvafaesrirketiaaedi
00368621   1/1  gGhaPdiikvaglpnvlpsstnPtlpytvntldehldmlmvchhldpdipedvafaesrirketiaaedv
00465711   1/1  gghaPdiielaglpnvlpsstnptlpltvntldehldmlmvchhldkdipedvafaesriraetiaaedv
00464991   1/2  ----------------------------------------------------------------------
00370431   1/1  ......................................................................
00533521   1/2  ----------------------------------------------------------------------
00399341   1/1  slkalfelAekygllvdiHvdetldpgsrvletlaeiaealgllgrvlisHatslsslseeeveellkll
00530931   1/1  apedlleilelleegdiviHcfhgsaagilvaeeatllelalealelGvyidigggstfknakalrealk
00527891   1/1  iddlleilkeegilggvlhlfsgpaeaEavaaaraldlarypglplhithlstkealeliraapleglnv
00470061   1/1  ggvlhlfsrpaeaeaeaidralylaeftglrlhivhvttkeavelieaakalgldvtaetdphhL.llte
00510861   1/1  lrlhlhsrpaeaeaaaiaralllarltglrlhivhvstaealeliraakakglnvtaettphhLlltded
00533522   2/2  kagnpdirdg............................................................
00470051   1/1  ......................................................................
00419481   1/1  ......................................................................
00444561   1/1  ......................................................................
00470041   1/1  ......................................................................
00530921   1/1  ......................................................................
00477851   1/2  ----------------------------------------------------------------------
00475181   1/1  ......................................................................
00464992   2/2  ----------------------------------------------------------------------
00400311   1/1  ----------------------------------------------------------------------
00527601   1/1  dlleilleegltggvlhlfsrpaeaelealalglllasftglplhivhvstkealelieaakalgl.rvt
00457091   1/1  lelalklgadlivgvdlvgdergfspellrelllafelarelglpvtiHagEtgd...plelldalgllg
00478651   1/1  dlvggvdlpgdepgfspellylyrelfelarelglpvtiHagEtgdeg...glldalgllgadrigHgvh
00408331   1/1  ----------------------------------------------------------------------
00381371   1/1  ----------------------------------------------------------------------
00477852   2/2  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           LHDIGAISMTSSDSQAMGRVGEVIIRTWQVADKMKKQRGALAGENGNDNVRAKRYIAKYTINPAITHGLS
00456111   1/1  lhdlGalsllssdsqamGrvgevilrtwqtadkmkaqrgaleedserndnlrvkryvakytinpaiahGi
00368621   1/1  lhDlGalslissdsqamGrvGevilrtwqtadkmkkqrGaleedsglndnlrvkryiakytinPaiahGi
00465711   1/1  lhdlGaisvvssdsqamgrvgevilrtwqtahkmklqrGllledgglndnfrvkryiakytinPAiahGl
00464991   1/2  ----------------------------------------------------------------------
00370431   1/1  ......................................................................
00533521   1/2  ----------------------------------------------------------------------
00399341   1/1  aeagi.svvvlPlsnlylqgredtvpvlrgvtpvke.......................lldaGvnvslG
00530931   1/1  igld------------------------------------------------------------------
00527891   1/1  taetdphhLllt.pedlavaesllrdlvllgsdl..dlivlsllsedlpeglgtllkvlPplrskedrea
00470061   1/1  edvaglgtlfkclPplrseedreaLwealad.gtidviasdhaPhtleekelglgdflkapaGipgleta
00510861   1/1  lgglgtlakcnPplrs.........eedrealwealad.gvidaiatDhaphpleeklnfpeapnGipgl
00533522   2/2  ............................................................vnpalivgly
00470051   1/1  ......................................................................
00419481   1/1  ......................................................................
00444561   1/1  ......................................................................
00470041   1/1  ......................................................................
00530921   1/1  ......................................................................
00477851   1/2  ----------------------------------------------------------------------
00475181   1/1  ......................................................................
00464992   2/2  ----------------------------------------------------------------------
00400311   1/1  ----------------------------------------------------------------------
00527601   1/1  aettphhlllteedllelgialgtlakllPplrldeedrealwealadgvidaigsDhaphtleekelgk
00457091   1/1  adrigHgvhltede.....lLidllaeagiglvvc.PtsNlklglvsglak.....hp............
00478651   1/1  ltedelLidllaeagigvvvcPtsnlklglvsgladhP................................
00408331   1/1  ----------------------------------------------------------------------
00381371   1/1  ----------------------------------------------------------------------
00477852   2/2  -----------------------------------------------------eavrllslnpakilglp


                         -         -         +         -         -         -         -:490
query           HEVGSVEKGKLADLVLWDPVFFGVKPELVLKGGMIARAQMGDPNASIPTPEPVFMRQMYASYGKANRSTS
00456111   1/1  aeevGsvevGkladl................................................ggalaat
00368621   1/1  sdlvGsvevGklad................................................lgkalaat
00465711   1/1  shevG....................................................pmfgalgkalaal
00464991   1/2  ----------------------------------------------------------------------
00370431   1/1  ...GsievGklADlvlwdpdllavlpalilksgvvttvvdGrvvvgiptltivrgrl-------------
00533521   1/2  ----------------------------------------------------------------------
00399341   1/1  sDnvaDpfypvgd---------------------------------------------------------
00530931   1/1  ----------------------------------------------------------------------
00527891   1/1  lweal-----------------------------------------------------------------
00470061   1/1  lpll------------------------------------------------------------------
00510861   1/1  et--------------------------------------------------------------------
00533522   2/2  pekgtievgsdtadlvlwdPeklvviedsalkgaldasalegdkvkgvptpqpvlgrrlygt--------
00470051   1/1  ...gslavGadADlvlvdp---------------------------------------------------
00419481   1/1  ...GliepgkdADlvlldp...dllveevivrGelvaad-------------------------------
00444561   1/1  ....GsievGkdADlvlldld...llvlltivgGkl----------------------------------
00470041   1/1  ...........ADlvvvdp---------------------------------------------------
00530921   1/1  .....flevGkdaDltifdldpellllkdgvtplvgle--------------------------------
00477851   1/2  ----------------------------------------------------------------------
00475181   1/1  .....GsleeGklADlvll---------------------------------------------------
00464992   2/2  -----------adlvvwllalsgvkpnliikggfialsqlgdaggsiptplppgprella----------
00400311   1/1  ----------------------------------------------------------------------
00527601   1/1  .....-----------------------------------------------------------------
00457091   1/1  ...........v----------------------------------------------------------
00478651   1/1  ................------------------------------------------------------
00408331   1/1  ----------------------------------------------------------------------
00381371   1/1  ----------------------------------------------------------------------
00477852   2/2  pnkGs-----------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           ITFMSQASIERGVAESLGLEKRISPVKNIRKLSKLDMKLNSALPKIEIDPKTYQVFADGEELSCQPVDYV
00456111   1/1  sltfvsqaaledglleklglekrlvavknvrglgkkdlllndalpkievdpetyevrvdGelltvepaee
00368621   1/1  svtfvsqaaledgvleelglekrllpvknvrnlgkkdlklndalpkievdpetyevrvdGelltaePaee
00465711   1/1  svtFvskaaleaglleslglkkrllpvkntrglskkdmvlndalPkievdpetyevrvdGelltaepaee
00464991   1/2  ----------------------------------------------------------------------
00370431   1/1  ----------------------------------------------------------------------
00533521   1/2  ----------------------------------------------------------------------
00399341   1/1  ----------------------------------------------------------------------
00530931   1/1  ----------------------------------------------------------------------
00527891   1/1  ----------------------------------------------------------------------
00470061   1/1  ----------------------------------------------------------------------
00510861   1/1  ----------------------------------------------------------------------
00533522   2/2  ----------------------------------------------------------------------
00470051   1/1  ----------------------------------------------------------------------
00419481   1/1  ----------------------------------------------------------------------
00444561   1/1  ----------------------------------------------------------------------
00470041   1/1  ----------------------------------------------------------------------
00530921   1/1  ----------------------------------------------------------------------
00477851   1/2  ----------------------------------------------------------------------
00475181   1/1  ----------------------------------------------------------------------
00464992   2/2  ----------------------------------------------------------------------
00400311   1/1  ----------------------------------------------------------------------
00527601   1/1  ----------------------------------------------------------------------
00457091   1/1  ----------------------------------------------------------------------
00478651   1/1  ----------------------------------------------------------------------
00408331   1/1  ----------------------------------------------------------------------
00381371   1/1  ----------------------------------------------------------------------
00477852   2/2  ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           PLGQRYFLF-------------------------------------------------------------
00456111   1/1  lplaqryfl-------------------------------------------------------------
00368621   1/1  lplaqryfl-------------------------------------------------------------
00465711   1/1  lPlaqryfl-------------------------------------------------------------
00464991   1/2  ----------------------------------------------------------------------
00370431   1/1  ----------------------------------------------------------------------
00533521   1/2  ----------------------------------------------------------------------
00399341   1/1  ----------------------------------------------------------------------
00530931   1/1  ----------------------------------------------------------------------
00527891   1/1  ----------------------------------------------------------------------
00470061   1/1  ----------------------------------------------------------------------
00510861   1/1  ----------------------------------------------------------------------
00533522   2/2  ----------------------------------------------------------------------
00470051   1/1  ----------------------------------------------------------------------
00419481   1/1  ----------------------------------------------------------------------
00444561   1/1  ----------------------------------------------------------------------
00470041   1/1  ----------------------------------------------------------------------
00530921   1/1  ----------------------------------------------------------------------
00477851   1/2  ----------------------------------------------------------------------
00475181   1/1  ----------------------------------------------------------------------
00464992   2/2  ----------------------------------------------------------------------
00400311   1/1  ----------------------------------------------------------------------
00527601   1/1  ----------------------------------------------------------------------
00457091   1/1  ----------------------------------------------------------------------
00478651   1/1  ----------------------------------------------------------------------
00408331   1/1  ----------------------------------------------------------------------
00381371   1/1  ----------------------------------------------------------------------
00477852   2/2  ----------------------------------------------------------------------