[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cele0:AAA81130.1


[Show Plain Result]

## Summary of Sequence Search
   1::914
  53::167  PF00565 0.0% 24.2718446601942  Staphylococcal nuclease homologue 
 221::327  PF00565 0.0% 30.0970873786408  Staphylococcal nuclease homologue 
 368::491  PF00565 0.0% 30.188679245283  Staphylococcal nuclease homologue 
 552::667  PF00565 0.0% 36.8932038834951  Staphylococcal nuclease homologue 
 815::905  PF00565 0.0% 23.5294117647059  Staphylococcal nuclease homologue 
 688::807  PF00567 0.0% 36.4406779661017  Tudor domain 
   1::914


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTDAAAATPTVPPPAASSANPAVRRGLVKSVLSGDAVILQGQPHNGPPPEWTVYLSNVTAPRLGRRPTDS
PF00565         ----------------------------------------------------vrLvgidaPetakpkk..
PF00565         ----------------------------------------------------vrLvgidaPetakpkk..
PF00565         ----------------------------------------------------vrLvgidaPetakpkk..
PF00565         ----------------------------------------------------vrLvgidaPetakpkk..
PF00565         ----------------------------------------------------vrLvgidaPetakpkk..
PF00567         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           ASATPDEPYAWDSREYLRQKLVGQFVTFVRDFTATSGRDHGRIYLGGTSPADAENVAEGAVSAGLLEVRQ
PF00565         ....tvqpfgkeAkeflkklvlqkkvvvleldkkkDkygrllayvyln......kknineeLvkeGlArv
PF00565         ....tvqpfgkeAkeflkklvlqkkvvvleldkkkDkygrllayvyln......kknineeLvkeGlArv
PF00565         ....tvqpfgkeAkeflkklvlqkkvvvleldkkkDkygrllayvyln......kknineeLvkeGlArv
PF00565         ....tvqpfgkeAkeflkklvlqkkvvvleldkkkDkygrllayvyln......kknineeLvkeGlArv
PF00565         ....tvqpfgkeAkeflkklvlqkkvvvleldkkkDkygrllayvyln......kknineeLvkeGlArv
PF00567         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           GKVADEYSTKLLELQEQAKSAGRGKWNSNAGTIRDIRWVIDNPRELVDKYAQKPIDAVIEMVRDGSTVRA
PF00565         yevyekneekkkellkaeeeAkkkrkg-------------------------------------------
PF00565         yevyekneekkkellkaeeeAkkkrkg-------------------------------------------
PF00565         yevyekneekkkellkaeeeAkkkrkg-------------------------------------------
PF00565         yevyekneekkkellkaeeeAkkkrkg-------------------------------------------
PF00565         yevyekneekkkellkaeeeAkkkrkg-------------------------------------------
PF00567         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           FLLPNFEYITLQLSGVRAPSTRNPNAADSRAEAFSEEAKFFAESRLLQRDVQIILESTSNQNFVGSIVHP
PF00565         ----------vrLvgidaPetakpkk...tvqpfgkeAkeflkklvlqkkvvvleldkkkDkygrllayv
PF00565         ----------vrLvgidaPetakpkk...tvqpfgkeAkeflkklvlqkkvvvleldkkkDkygrllayv
PF00565         ----------vrLvgidaPetakpkk...tvqpfgkeAkeflkklvlqkkvvvleldkkkDkygrllayv
PF00565         ----------vrLvgidaPetakpkk...tvqpfgkeAkeflkklvlqkkvvvleldkkkDkygrllayv
PF00565         ----------vrLvgidaPetakpkk...tvqpfgkeAkeflkklvlqkkvvvleldkkkDkygrllayv
PF00567         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           KGNIAESLLREGYAKCVDWSIGLCTGGAQKLRDAERQAKEKRLRLWKSYQPTSSAYSGDRKAFTGKVVEI
PF00565         ylnkknineeLvkeGlArvye.vyekneekkkellkaeeeAkkkrkg-----------------------
PF00565         ylnkknineeLvkeGlArvye.vyekneekkkellkaeeeAkkkrkg-----------------------
PF00565         ylnkknineeLvkeGlArvye.vyekneekkkellkaeeeAkkkrkg-----------------------
PF00565         ylnkknineeLvkeGlArvye.vyekneekkkellkaeeeAkkkrkg-----------------------
PF00565         ylnkknineeLvkeGlArvye.vyekneekkkellkaeeeAkkkrkg-----------------------
PF00567         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           VLSDAVVVQKDDGSEVKLHLSSIRLPRESGDDKATGGPGRQFRPLYDIPFMFQAREFLRKRLLGKKVQIQ
PF00565         -----------------vrLvgidaPetakpkk............tvqpfgkeAkeflkklvlqkkvvvl
PF00565         -----------------vrLvgidaPetakpkk............tvqpfgkeAkeflkklvlqkkvvvl
PF00565         -----------------vrLvgidaPetakpkk............tvqpfgkeAkeflkklvlqkkvvvl
PF00565         -----------------vrLvgidaPetakpkk............tvqpfgkeAkeflkklvlqkkvvvl
PF00565         -----------------vrLvgidaPetakpkk............tvqpfgkeAkeflkklvlqkkvvvl
PF00567         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           IDYVQPKSENFPEKTCATIKIGDQNIAEGLISRGLSKVVRHRADDENRSSEYDTLLAAEANAEKGKKGLF
PF00565         eldk...kkDkygrllayvylnkknineeLvkeGlArvye.vyek..neekkkellkaeeeAkkkrkglW
PF00565         eldk...kkDkygrllayvylnkknineeLvkeGlArvye.vyek..neekkkellkaeeeAkkkrkglW
PF00565         eldk...kkDkygrllayvylnkknineeLvkeGlArvye.vyek..neekkkellkaeeeAkkkrkglW
PF00565         eldk...kkDkygrllayvylnkknineeLvkeGlArvye.vyek..neekkkellkaeeeAkkkrkglW
PF00565         eldk...kkDkygrllayvylnkknineeLvkeGlArvye.vyek..neekkkellkaeeeAkkkrkglW
PF00567         ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           ADKTAEKKDTHRIQEITGDLAKAKQFLPYLQRGGRAEGVVEFLSGGSRLRIYIPKETVLITFLLGGINCP
PF00565         s------------------------------------------------------------vrLvgidaP
PF00565         s------------------------------------------------------------vrLvgidaP
PF00565         s------------------------------------------------------------vrLvgidaP
PF00565         s------------------------------------------------------------vrLvgidaP
PF00565         s------------------------------------------------------------vrLvgidaP
PF00567         ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           KGARVGPGGVSTGAAEPFADEAAAFTRKLVLQHEVQLEVESTDKNGNFVGYLYVSPDGNTSRAINLSEAL
PF00565         etakpkk......tvqpfgkeAkeflkklvlqkkvvvleldkkkDkygrllayvyln.......kknine
PF00565         etakpkk......tvqpfgkeAkeflkklvlqkkvvvleldkkkDkygrllayvyln.......kknine
PF00565         etakpkk......tvqpfgkeAkeflkklvlqkkvvvleldkkkDkygrllayvyln.......kknine
PF00565         etakpkk......tvqpfgkeAkeflkklvlqkkvvvleldkkkDkygrllayvyln.......kknine
PF00565         etakpkk......tvqpfgkeAkeflkklvlqkkvvvleldkkkDkygrllayvyln.......kknine
PF00567         ----------------------------------------------------------------------


                         -         +         -         -         -         -         *:700
query           VENGLASLHFTAERSGHYNALLSAENKAKKAKKNIWANFTEEQHQEEVEVQQADTSERKQNFRQVAVTDI
PF00565         eLvkeGlArvyevyekneekkkellkaeeeAkkkrkg---------------------------------
PF00565         eLvkeGlArvyevyekneekkkellkaeeeAkkkrkg---------------------------------
PF00565         eLvkeGlArvyevyekneekkkellkaeeeAkkkrkg---------------------------------
PF00565         eLvkeGlArvyevyekneekkkellkaeeeAkkkrkg---------------------------------
PF00565         eLvkeGlArvyevyekneekkkellkaeeeAkkkrkg---------------------------------
PF00567         ---------------------------------------------------------pegetikvvvtei


                         -         -         -         -         +         -         -:770
query           APGALRFSAQNIEDGPKIEKMTTEMRQALAEHPPLAGSYTTKRGDLCVAKFSQDGQWYRCKVESVRAGQA
PF00565         ----------------------------------------------------------------------
PF00565         ----------------------------------------------------------------------
PF00565         ----------------------------------------------------------------------
PF00565         ----------------------------------------------------------------------
PF00565         ----------------------------------------------------------------------
PF00567         e.spgkfyvqpkeqdkkleklteelqeyyaskkp.veslapkvgdgcvalfsedgkwyRAkitvslddek


                         -         -         *         -         -         -         -:840
query           EIVYIDYGNRETIEAVKLAQIPAGFANFPAGVREYNLALAKLPNEDYVQLTSDAFAQYLFGHSSVFINSE
PF00565         --------------------------------------------qpfgkeAkeflkklvlqkkvvvleld
PF00565         --------------------------------------------qpfgkeAkeflkklvlqkkvvvleld
PF00565         --------------------------------------------qpfgkeAkeflkklvlqkkvvvleld
PF00565         --------------------------------------------qpfgkeAkeflkklvlqkkvvvleld
PF00565         --------------------------------------------qpfgkeAkeflkklvlqkkvvvleld
PF00567         veVlfiDyGntetvpvsdlrelpselaelppqaikcr---------------------------------


                         +         -         -         -         -         *         -:910
query           YKVGTSEYVTVYYDSGNKKVDIGKSLIAEGLALADHRREPRLQTLVNDYNTTEEVARKSRKNIWEYGDFT
PF00565         kkkDkyg.rllayvyln....kknineeLvkeGlArvyevyek.neekkkellkaeeeAkkkrkg-----
PF00565         kkkDkyg.rllayvyln....kknineeLvkeGlArvyevyek.neekkkellkaeeeAkkkrkg-----
PF00565         kkkDkyg.rllayvyln....kknineeLvkeGlArvyevyek.neekkkellkaeeeAkkkrkg-----
PF00565         kkkDkyg.rllayvyln....kknineeLvkeGlArvyevyek.neekkkellkaeeeAkkkrkg-----
PF00565         kkkDkyg.rllayvyln....kknineeLvkeGlArvyevyek.neekkkellkaeeeAkkkrkg-----
PF00567         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:980
query           GNDI------------------------------------------------------------------
PF00565         ----------------------------------------------------------------------
PF00565         ----------------------------------------------------------------------
PF00565         ----------------------------------------------------------------------
PF00565         ----------------------------------------------------------------------
PF00565         ----------------------------------------------------------------------
PF00567         ----------------------------------------------------------------------