[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cele0:AAF02170.1


[Show Plain Result]

## Summary of Sequence Search
   1::119
  36::102  PF05180 0.0% 53.8461538461538  DNL zinc finger 
   1::119


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MLRSAVSALYRASRSFSETVPRLSATPLGKQEPQLSLSYTCKVCNSREGPKTFAKSSYEKGVVIVTCSGC
PF05180         -----------------------------------qltftCkkCgtrsk.ktiskqaYekGvVlvqCpgC


                         -         -         *         -         -         -         -:140
query           HNHHIIADNIGWFEDFKGKNIEDHLKTRGEAVKRRDTIKNENGIFEIQK---------------------
PF05180         knrHliaDnLglfke.ekeniedilaekgeev--------------------------------------