[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cele0:AAN63415.1


[Show Plain Result]

## Summary of Sequence Search
   1::400
 201::378  PF00534 0.0% 36.969696969697  Glycosyl transferases group 1 
   1::400


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MVRVTILHPDLGIGGAERLIVDAAVGLQDRGHSVRIFTNQYSRSHCFQETLDLDICTVVPWIPRSIFGKG
PF00534         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           HALCAYLKMIIAALYIVIYHKDTDVILSDSVSASQFVLRHFSKAKLVFYCHFPDRLLTKRDGNLKAFYRN
PF00534         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           IIDWIEEYTTGLADVICVNSNFTKNVVRETFKSLASQELTVLYPSLNTEFFDSIEASDDFGEEIPRGTKY
PF00534         ------------------------------------------------------------kklgknekkk


                         -         -         -         +         -         -         -:280
query           VFTSLNRFERKKNIVLALDAFEKLKSNLPADEFSQCHLVIAGGYDLKNPENIEHYDELVEHMKKLELPAD
PF00534         iilsvgrlekeKgvdllikafallkeq....enpnlklvivG........dgeeekelkklaeelelsdn


                         -         *         -         -         -         -         +:350
query           QIVFLHSPSDTQKVNLIRRSRAVLYTPDREHFGIVPVEAMYLGTPVIAVNTGGPCESVRNNETGFLVDQT
PF00534         vifvgevp.redleelyrnadifvlpsrsEgfGivllEAmaaglpviasnvggpaeivkdgvtGllvkpk


                         -         -         -         -         *         -         -:420
query           AEAFAEKMIDLMKDEEMYRRMSEEGPKWVQKVFAFEAFARKLDEIIQSTL--------------------
PF00534         daealaeaiekllkdeelrerlgenark------------------------------------------