[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cele0:CAA21529.1


[Show Plain Result]

## Summary of Sequence Search
   1::180
  17::174  PF06703 0.0% 36.3057324840764  Microsomal signal peptidase 25 kDa subunit (SPC25) 
   1::180


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTDEPVKVVNKWDGPTVKNALDEVVKKILNDKVGWTESHNLMNLRLLISFIGVAFSAFACGYDYYEPFPK
PF06703         ----------------lknalDdavkkvlssl.gykeshkltdlrLaLGyvavaiaiaaflwdyklefpe


                         -         -         *         -         -         -         -:140
query           SKIVLAVCSVSYFICMGILQMYQWYVEKDCIYEATEVDGKQSRKWAWSSEIKAHDDKYTLSAEFKKEGRS
PF06703         skpvlaaavvlYfvlsgiltlvskfvekniiyvgkrkdtteeekltiasslkkhdplytltievtdksse


                         +         -         -         -         -         *         -:210
query           GQGKITKSIGAYIDNDGEIIVPLVKKEVDDLYNRLIRSEQ------------------------------
PF06703         aarevelelsvaewfdedGelvedefekllssll------------------------------------