[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cele0:CAA21685.2


[Show Plain Result]

## Summary of Sequence Search
   1::411
  86::317  PF00566 0.0% 24.2857142857143  TBC domain 
   1::411


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MHSSFSEPNSPLKEVLVDKWQTASCSDLGEEYVKPGPLARAKFNALRNKREAIDRFLKKHRKEDLSLYID
PF00566         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           ELRDFAISPGGLVDDEFRAVIWPVLSANLVQNDDLDDVSSSYDSDFESAQSDFDEEPAYEESEELTLEDL
PF00566         ---------------elRgevWklllgyee...............krkrlkssekkqeeskkekskleke


                         +         -         -         -         -         *         -:210
query           KGHKEWNQVELDVHRTLSRFPPNISDTHRDVLQTELIPLIVRVLSINPRFNYYQGFHDICLTVLLVCGEV
PF00566         edekeesqIekDvpRtfp....hdelfkneegqnqLeriLkayaiynpevgYcqGmnfiaallLlvvlde


                         -         -         -         +         -         -         -:280
query           DALPVCSNLAKNGSFNNYLLKTLEKSVVRELDLLYVILSRVDPSLEQVMRSVELGTMFGLSWPLTWFSHT
PF00566         eeafwcfvsLl.nkklrdlfkpslpg.lqrdlqileellkkhdpelykhlekeeldlslfaikwfltlfa


                         -         *         -         -         -         -         +:350
query           LKQYQQIVRFFDVFLASSPLLPIYVSAAVVVFRRASILACEREMPFLHRLLTEMPHELPIDTIIKDSVYL
PF00566         relpl.etvlrlwDlllegakflllrialailkllrk---------------------------------


                         -         -         -         -         *         -         -:420
query           SKLMPPCLLKTKYTNEYRKIVSKPSKAAVKTIPRYALQFMFVAGTVGAAASFFFFKQIHPM---------
PF00566         ----------------------------------------------------------------------