[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cele0:CAA87773.1


[Show Plain Result]

## Summary of Sequence Search
   1::294
   3::115  PF01398 0.0% 24.7619047619048  Mov34/MPN/PAD-1 family 
   1::294


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MASNLTVNVHPGVYMNVVDTHMRRTKSSAKNTGQEKCMGTLMGYYEKGSIQVTNCFAIPFNESNDDLEID
PF01398         --svqavhleslvllkildhalrteke........evmGlliGelnddttveitnvfalprsetekdvda


                         -         -         *         -         -         -         -:140
query           DQFNQQMISALKKTSPNEQPVGWFLTTSDITSSCLIYHDYYVRVITEASARRESPPIVVLTIDTTFSGDM
PF01398         veldqeylekksellkklrgrervVGWYhshphitvwlshvdvrt-------------------------


                         +         -         -         -         -         *         -:210
query           SKRMPVRAYLRSKAGIPGAAGPHCAIFNPLRVELAAFPGELVAMQLIEKALDSRRREATLESGLEQLETS
PF01398         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           TAQMIEWLERMLHYVEDVNKNGEKPGDAQIGRQLMDIVTASSNNMQPEKLDTLVKNTLRDYVMVSYLAKL
PF01398         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           TQTQLQVHERLVSA--------------------------------------------------------
PF01398         ----------------------------------------------------------------------