[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cele0:CAA93431.1


[Show Plain Result]

## Summary of Sequence Search
   1::305
  19::248  PF00069 0.0% 30  Protein kinase domain 
  21::248  PF07714 0.0% 23.943661971831  Protein tyrosine kinase 
  23::79   PF01636 0.0% 27.4509803921569  Phosphotransferase enzyme family 
 126::173  PF01636 0.0% 29.5454545454545  Phosphotransferase enzyme family 
   1::305


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MATICELVQLPVGSECGKWTILKKLGEGAFGAVYLVSQKEKPKVEYALKVEAESDPLGLLKMEVAVLLEV
PF00069         ------------------yelleklGsGsfGkVykakkkktgk.kvAvKilkkeeekskkektavrElki
PF07714         --------------------lgkklGeGafGkVvegtlkgekekkevkVavKtlkekaeeeekeefleea
PF01636         ----------------------relsggasnrtyrvttgag...ryvlrrarparaaeelrrevallrlL
PF01636         ----------------------relsggasnrtyrvttgag...ryvlrrarparaaeelrrevallrlL


                         -         -         *         -         -         -         -:140
query           KKQKIVGRHFLELADRGNLPQKFNYMVMTLVGKSLQDLRKTAPFNKFSMGTAISVARQSLEAVEDLHNIG
PF00069         lkklsHpniv..kllevfee....kdelylvleyveggdlfdllk..kegklseeeikkialqilegley
PF07714         kimkklkhenivkllgvct.keep.....llivteyvkgGdLlefLrkkekekltlkdllkfalqiAkGm
PF01636         akagi...p----------------------------------------------eervlaalaallpga
PF01636         akagi...p----------------------------------------------eervlaalaallpga


                         +         -         -         -         -         *         -:210
query           FLHRDIKPGNYTIGRKEMHELRKVYMLDFGMARKFAREDGTLRNPRARAGFRGTVKYAPLACHIQREQCR
PF00069         lHsngiiHrDLKpeNiLldkkgel.....kiaDFGlakkl......eksseklttlvgtreYmAPEvllk
PF07714         eyLeskklvHrdLaarNvLlee.....ekvvkisDfGLardiekddyy....kkkeeaklpvkWmapEsl
PF01636         eppvllHgDlhpgNllvd....pddgrvGviDf-------------------------------------
PF01636         eppvllHgDlhpgNllvd....pddgrvGviDf-------------------------------------


                         -         -         -         +         -         -         -:280
query           KDDIESWLYMVVEMTCGRLPWRNLTESDDVGVFKKECKTTRLRCLFGGCPREFTEVFPILDKGKFFDAPE
PF00069         akeytkkvDvWslGvilyelltgklpfsgeseedqlel--------------------------------
PF07714         kekkftsksDvWsfGvllwEiftlgespypglsneevl--------------------------------
PF01636         ----------------------------------------------------------------------
PF01636         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           YTTIYELLEKAMVNTKSNEFPYDWE---------------------------------------------
PF00069         ----------------------------------------------------------------------
PF07714         ----------------------------------------------------------------------
PF01636         ----------------------------------------------------------------------
PF01636         ----------------------------------------------------------------------