[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cele0:CAB01696.1


[Show Plain Result]

## Summary of Sequence Search
   1::245
  10::201  PF04511 0.0% 36.5079365079365  Der1-like family 
   1::245


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MDLENFLLGIPIVTRYWFLASTIIPLLGRFGFINVQWMFLQWDLVVNKFQFWRPLTALIYYPVTPQTGFH
PF04511         ---------iPpvTriyllatvllsvlirlnlinplklifdfnlvfkkvqiwRlltsllyl...gnlglq


                         -         -         *         -         -         -         -:140
query           WLMMCYFLYNYSKALESETYRGRSADYLFMLIFNWFFCSGLCMALDIYFLLEPMVISVLYVWCQVNKDTI
PF04511         fllnlyflyqyssslEeshfkkraedylilLifgavlillltiianlsqlnlvvLgqvlitaivYvWsrk


                         +         -         -         -         -         *         -:210
query           VSFWFGMRFPARYLPWVLWGFNAVLRGGGTNELVGILVGHAYFFVALKYPDEYGVDLISTPEFLHRLIPD
PF04511         neqvqinffelirvkaeylPlvllifsillknesllveligilsgylyfflkfnylrllfG---------


                         -         -         -         +         -         -         -:280
query           EDGGIHGQDGNIRGARQQPRGHQWPGGVGARLGGN-----------------------------------
PF04511         ----------------------------------------------------------------------