[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cele0:CAB01743.1


[Show Plain Result]

## Summary of Sequence Search
   1::166
  34::142  PF10233 0.0% 39.4495412844037  Uncharacterized conserved protein CG6151-P 
   1::166


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MGAAASGVSTQMQAEHDPNAAFPWWVRFLAKGVAILGGFLSLFFGVLGLITLSATCMVAILLQMTAGALV
PF10233         ---------------------------------gilsillcialGianlftisavcivfgillivaglvv


                         -         -         *         -         -         -         -:140
query           IALEAPFCCQFVDFIEKIARFSESRALWHKAAIYGAMGLIPIFLCIELNTILGSGTIFASGVIYGFMALG
PF10233         lfiEvPfllrivplsekfaefiekfetnweraalYlimavvqyislileltsLlgvavilaitgvlYala


                         +         -         -         -         -         *         -:210
query           KKADRSNMMAAGDPAWSPQVNQSNIP--------------------------------------------
PF10233         al--------------------------------------------------------------------