[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cele0:CAC35840.2


[Show Plain Result]

## Summary of Sequence Search
   1::795
   8::150  PF10513 0.0% 37.410071942446  Enhancer of polycomb-like 
   1::795


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MATTSKAFRARALDSNRSMTVYWGHELPDLSECSVGNRAVTQMPSGMEKEEEQEKHLQEAIAAQQASTSG
PF10513         -------erqrrldiktklevvreedlksleksesssskeqeveatetgvekeehqsqqekekhlqrpis


                         -         -         *         -         -         -         -:140
query           IQLNHVIPTPKVDRVEDQRYHSTYHNKNKMHRSKYIKVHAWQALERDEPEYDYDTEDEAWLSDHTHIDPR
PF10513         aneakekkknkekltiptPdfrvve...yeksyapkfkkPs.syiryseksveeldeeveYDmDeeDekW


                         +         -         -         -         -         *         -:210
query           VLEKIFDTVESHSSETQIASEDSVINLHKSLDSSIVYEIYEYWLSKRTSAATTSGCVGVGGLIPRVRTEC
PF10513         Leelnkkrke------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           RKDGQGVINPYVAFRRRAEKMQTRKNRKNDEDSYEKILKLVHDMSKAQQLFDMTARREKQKLALIDMESE
PF10513         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           ILAKRMEMSDFGGSPSSFNEITEKIRAAATLEVVKPPLAEINGSDEVKKRKKPRRKIADKDLISKAWLKK
PF10513         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           NAESWNRPPSLFGQHSGNVPTVTTKPVRESLANGRFAFKRRRGCVYRAALTVYNVPTAPATVPPVQTQAA
PF10513         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           VASSSSSKSTDMVPSNMKFFETFVRDSQDSVSRSLGFVRRRMGRGGRVVFDRMPRNRDDNDERTSTDPWA
PF10513         ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           EYCVADSSRTFRARNSSLGTEEETDDLSPKSLYFARSNRFAFNDDETEREWTSRCQQSSWRDTEVDDELK
PF10513         ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           KRETTSEKFTETTTNGSTKTHTESDDSEVERMEVDDQVDEAQITVSSSKDDGMNGNDKNEDEEDDDDDMD
PF10513         ----------------------------------------------------------------------


                         -         +         -         -         -         -         *:700
query           VDEHQTVVGVHQHQQQQHHQQKVRHQMNGGGGGGGVVKLKPPLQELSPPLSGNGRADRAEPTPVPAKMCG
PF10513         ----------------------------------------------------------------------


                         -         -         -         -         +         -         -:770
query           TVSDSDDWREPSGSPSESNSSTEWGGYTPQEQHAVVVANAVAVAFKEKLMNGVDDDDDQQPSPARGARDH
PF10513         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:840
query           SIKDSMSTVTLLERKKFMMPSTIGL---------------------------------------------
PF10513         ----------------------------------------------------------------------