[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for cele0:AAA81130.1


[Show Plain Result]

## Summary of Sequence Search
   1::914
 517::675  1.2e-26 34.7% 0047647 00476474 4/5   ylococcal nuclease                      
 186::332    2e-26 27.0% 0047647 00476472 2/5   ylococcal nuclease                      
 334::499  4.7e-22 32.9% 0047647 00476473 3/5   ylococcal nuclease                      
  15::175  1.7e-19 32.6% 0047647 00476471 1/5   ylococcal nuclease                      
 714::811    4e-19 33.3% 0052440 00524401 1/1   /PWWP/MBT                               
 716::804  5.2e-19 36.4% 0053036 00530361 1/1   /PWWP/MBT                               
 738::794  1.3e-15 38.6% 0040933 00409332 2/2   /PWWP/MBT                               
 749::913  4.3e-15 27.8% 0047647 00476475 5/5   ylococcal nuclease                      
 739::796  1.6e-14 39.7% 0052413 00524132 2/2   /PWWP/MBT                               
 323::379      2.9 24.6% 0040933 00409331 1/2   /PWWP/MBT                               
 324::379       36 26.8% 0052413 00524131 1/2   /PWWP/MBT                               
   1::914


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTDAAAATPTVPPPAASSANPAVRRGLVKSVLSGDAVILQGQPHNGPPPEWTVYLSNVTAPRLGRRPTDS
00476474   4/5  ----------------------------------------------------------------------
00476472   2/5  ----------------------------------------------------------------------
00476473   3/5  ----------------------------------------------------------------------
00476471   1/5  --------------llflldgkllrakVvrVidGdtlvvll.....pgqgirvrLagidaPelgqlg...
00524401   1/1  ----------------------------------------------------------------------
00530361   1/1  ----------------------------------------------------------------------
00409332   2/2  ----------------------------------------------------------------------
00476475   5/5  ----------------------------------------------------------------------
00524132   2/2  ----------------------------------------------------------------------
00409331   1/2  ----------------------------------------------------------------------
00524131   1/2  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           ASATPDEPYAWDSREYLRQKLVGQFVTFVRDFTATSGRDHGRIYLGGTSPADAENVAEGAVSAGLLEVRQ
00476474   4/5  ----------------------------------------------------------------------
00476472   2/5  ----------------------------------------------------------------------
00476473   3/5  ----------------------------------------------------------------------
00476471   1/5  ...epeepygeeAreflrelllgkevtlevdytlegrdrygrllatvyldg......vnvneelveeGlA
00524401   1/1  ----------------------------------------------------------------------
00530361   1/1  ----------------------------------------------------------------------
00409332   2/2  ----------------------------------------------------------------------
00476475   5/5  ----------------------------------------------------------------------
00524132   2/2  ----------------------------------------------------------------------
00409331   1/2  ----------------------------------------------------------------------
00524131   1/2  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           GKVADEYSTKLLELQEQAKSAGRGKWNSNAGTIRDIRWVIDNPRELVDKYAQKPIDAVIEMVRDGSTVRA
00476474   4/5  ----------------------------------------------------------------------
00476472   2/5  ---------------------------------------------llflldgkllrakVvrVidGdtlvv
00476473   3/5  ----------------------------------------------------------------------
00476471   1/5  rvyrrylddsklldellaaeeeAkkaklglWsdgd-----------------------------------
00524401   1/1  ----------------------------------------------------------------------
00530361   1/1  ----------------------------------------------------------------------
00409332   2/2  ----------------------------------------------------------------------
00476475   5/5  ----------------------------------------------------------------------
00524132   2/2  ----------------------------------------------------------------------
00409331   1/2  ----------------------------------------------------------------------
00524131   1/2  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           FLLPNFEYITLQLSGVRAPSTRNPNAADSRAEAFSEEAKFFAESRLLQRDVQIILESTSNQNFVGSIVHP
00476474   4/5  ----------------------------------------------------------------------
00476472   2/5  ll.pgqg.irvrLagidaPelgqlg...epeepygeeAreflrelllgkevtlevdytlegrdrygrlla
00476473   3/5  ----------------------------------------------------------------------
00476471   1/5  ----------------------------------------------------------------------
00524401   1/1  ----------------------------------------------------------------------
00530361   1/1  ----------------------------------------------------------------------
00409332   2/2  ----------------------------------------------------------------------
00476475   5/5  ----------------------------------------------------------------------
00524132   2/2  ----------------------------------------------------------------------
00409331   1/2  ----------------------------------------------------------------------
00524131   1/2  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           KGNIAESLLREGYAKCVDWSIGLCTGGAQKLRDAERQAKEKRLRLWKSYQPTSSAYSGDRKAFTGKVVEI
00476474   4/5  ----------------------------------------------------------------------
00476472   2/5  tvyldgvnvneelveeGlArvyrryld.dsklldellaaeeeAkkaklglWs------------------
00476473   3/5  -----------------------------------------------------llflldgkllrakVvrV
00476471   1/5  ----------------------------------------------------------------------
00524401   1/1  ----------------------------------------------------------------------
00530361   1/1  ----------------------------------------------------------------------
00409332   2/2  ----------------------------------------------------------------------
00476475   5/5  ----------------------------------------------------------------------
00524132   2/2  ----------------------------------------------------------------------
00409331   1/2  ------------------------------------------llklkvgdlclakyseDglwyrAlilev
00524131   1/2  -------------------------------------------vlpkvgdlclakysedgkwyrAlilev


                         -         -         -         -         *         -         -:420
query           VLSDAVVVQKDDGSEVKLHLSSIRLPRESGDDKATGGPGRQFRPLYDIPFMFQAREFLRKRLLGKKVQIQ
00476474   4/5  ----------------------------------------------------------------------
00476472   2/5  ----------------------------------------------------------------------
00476473   3/5  idGdtlvvllpgqg.irvrLagidaPelgqlg............epeepygeeAreflrelllgkevtle
00476471   1/5  ----------------------------------------------------------------------
00524401   1/1  ----------------------------------------------------------------------
00530361   1/1  ----------------------------------------------------------------------
00409332   2/2  ----------------------------------------------------------------------
00476475   5/5  ----------------------------------------------------------------------
00524132   2/2  ----------------------------------------------------------------------
00409331   1/2  lesdgtvlVlfvdyGntevvplsdlrplp-----------------------------------------
00524131   1/2  llsnglvlVlfvdyGntevvplsdlrplp-----------------------------------------


                         -         -         +         -         -         -         -:490
query           IDYVQPKSENFPEKTCATIKIGDQNIAEGLISRGLSKVVRHRADDENRSSEYDTLLAAEANAEKGKKGLF
00476474   4/5  ----------------------------------------------------------------------
00476472   2/5  ----------------------------------------------------------------------
00476473   3/5  vdytlegrdry.grllatvyldgvnvneelveeGlArvyrryld...dsklldellaaeeeAkkaklglW
00476471   1/5  ----------------------------------------------------------------------
00524401   1/1  ----------------------------------------------------------------------
00530361   1/1  ----------------------------------------------------------------------
00409332   2/2  ----------------------------------------------------------------------
00476475   5/5  ----------------------------------------------------------------------
00524132   2/2  ----------------------------------------------------------------------
00409331   1/2  ----------------------------------------------------------------------
00524131   1/2  ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           ADKTAEKKDTHRIQEITGDLAKAKQFLPYLQRGGRAEGVVEFLSGGSRLRIYIPKETVLITFLLGGINCP
00476474   4/5  --------------------------llflldgkllrakVvrVidGdtlvvllpgqg..irvrLagidaP
00476472   2/5  ----------------------------------------------------------------------
00476473   3/5  sdgdpvpdd-------------------------------------------------------------
00476471   1/5  ----------------------------------------------------------------------
00524401   1/1  ----------------------------------------------------------------------
00530361   1/1  ----------------------------------------------------------------------
00409332   2/2  ----------------------------------------------------------------------
00476475   5/5  ----------------------------------------------------------------------
00524132   2/2  ----------------------------------------------------------------------
00409331   1/2  ----------------------------------------------------------------------
00524131   1/2  ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           KGARVGPGGVSTGAAEPFADEAAAFTRKLVLQHEVQLEVESTDKNGNFVGYLYVSPDGNTSRAINLSEAL
00476474   4/5  elgqlg......epeepygeeAreflrelllgkevtlevdytlegrdrygrllatvyl..dg.....vnv
00476472   2/5  ----------------------------------------------------------------------
00476473   3/5  ----------------------------------------------------------------------
00476471   1/5  ----------------------------------------------------------------------
00524401   1/1  ----------------------------------------------------------------------
00530361   1/1  ----------------------------------------------------------------------
00409332   2/2  ----------------------------------------------------------------------
00476475   5/5  ----------------------------------------------------------------------
00524132   2/2  ----------------------------------------------------------------------
00409331   1/2  ----------------------------------------------------------------------
00524131   1/2  ----------------------------------------------------------------------


                         -         +         -         -         -         -         *:700
query           VENGLASLHFTAERSGHYNALLSAENKAKKAKKNIWANFTEEQHQEEVEVQQADTSERKQNFRQVAVTDI
00476474   4/5  neelveeGlArvyrrylddsklldellaaeeeAkkaklglWsdgd-------------------------
00476472   2/5  ----------------------------------------------------------------------
00476473   3/5  ----------------------------------------------------------------------
00476471   1/5  ----------------------------------------------------------------------
00524401   1/1  ----------------------------------------------------------------------
00530361   1/1  ----------------------------------------------------------------------
00409332   2/2  ----------------------------------------------------------------------
00476475   5/5  ----------------------------------------------------------------------
00524132   2/2  ----------------------------------------------------------------------
00409331   1/2  ----------------------------------------------------------------------
00524131   1/2  ----------------------------------------------------------------------


                         -         -         -         -         +         -         -:770
query           APGALRFSAQNIEDGPKIEKMTTEMRQALAEHPPLAGSYTTKRGDLCVAKFSQDGQWYRCKVESVRAGQA
00476474   4/5  ----------------------------------------------------------------------
00476472   2/5  ----------------------------------------------------------------------
00476473   3/5  ----------------------------------------------------------------------
00476471   1/5  ----------------------------------------------------------------------
00524401   1/1  -------------nleeleklmeelqelysnll..lllllpkvgdlclakfsedglwyRalvlevlsdgl
00530361   1/1  ---------------eeleklmeelqelysslllllllllpkvgdlclakys.dglwyRAlvlevlsdgl
00409332   2/2  -------------------------------------llklkvgdlclakyseDglwyrAlilevlesdg
00476475   5/5  ------------------------------------------------llflldgkllrakVvrVidGdt
00524132   2/2  --------------------------------------vlpkvgdlclakysedgkwyrAlilevllsng
00409331   1/2  ----------------------------------------------------------------------
00524131   1/2  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:840
query           EIVYIDYGNRETIEAVKLAQIPAGFANFPAGVREYNLALAKLPNEDYVQLTSDAFAQYLFGHSSVFINSE
00476474   4/5  ----------------------------------------------------------------------
00476472   2/5  ----------------------------------------------------------------------
00476473   3/5  ----------------------------------------------------------------------
00476471   1/5  ----------------------------------------------------------------------
00524401   1/1  veVffvDyGntevvplsdlrplpeeflslppqaikcsLagv-----------------------------
00530361   1/1  veVffvDyGntetvplsdlrplppeflslpaqAi------------------------------------
00409332   2/2  tvlVlfvdyGntevvplsdlrplp----------------------------------------------
00476475   5/5  lvvll...pgqg.irvrLagidaPelgqlg...........epeepygeeAreflrelll.gkevtlevd
00524132   2/2  lvlVlfvdyGntevvplsdlrplpee--------------------------------------------
00409331   1/2  ----------------------------------------------------------------------
00524131   1/2  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:910
query           YKVGTSEYVTVYYDSGNKKVDIGKSLIAEGLALADHRREPRLQTLVNDYNTTEEVARKSRKNIWEYGDFT
00476474   4/5  ----------------------------------------------------------------------
00476472   2/5  ----------------------------------------------------------------------
00476473   3/5  ----------------------------------------------------------------------
00476471   1/5  ----------------------------------------------------------------------
00524401   1/1  ----------------------------------------------------------------------
00530361   1/1  ----------------------------------------------------------------------
00409332   2/2  ----------------------------------------------------------------------
00476475   5/5  ytlegrdrygrllatvyld....gvnvneelveeGlArvyrryld.dsklldellaaeeeAkkaklglWs
00524132   2/2  ----------------------------------------------------------------------
00409331   1/2  ----------------------------------------------------------------------
00524131   1/2  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:980
query           GNDI------------------------------------------------------------------
00476474   4/5  ----------------------------------------------------------------------
00476472   2/5  ----------------------------------------------------------------------
00476473   3/5  ----------------------------------------------------------------------
00476471   1/5  ----------------------------------------------------------------------
00524401   1/1  ----------------------------------------------------------------------
00530361   1/1  ----------------------------------------------------------------------
00409332   2/2  ----------------------------------------------------------------------
00476475   5/5  dgd-------------------------------------------------------------------
00524132   2/2  ----------------------------------------------------------------------
00409331   1/2  ----------------------------------------------------------------------
00524131   1/2  ----------------------------------------------------------------------