[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for cele0:AAC47965.1


[Show Plain Result]

## Summary of Sequence Search
   1::2076
  11::1182 8.5e-47 23.1% 0049802 00498021 1/2   epeat                                   
 850::1247 1.1e-25 22.8% 0050417 00504173 3/4   epeat                                   
  11::1035 5.4e-24 22.3% 0042771 00427711 1/2   epeat                                   
 863::1137 2.6e-21 23.1% 0047075 00470752 2/3   epeat                                   
  69::1007 3.5e-17 20.5% 0052026 00520261 1/2   epeat                                   
 459::1177 4.1e-16 25.4% 0051023 00510231 1/2   epeat                                   
 874::1230 1.7e-15 22.7% 0048921 00489213 3/4   epeat                                   
 813::1164 6.9e-15 20.5% 0046912 00469122 2/3   epeat                                   
  25::505  1.4e-14 23.6% 0047075 00470751 1/3   epeat                                   
  30::605  1.5e-14 20.9% 0045874 00458741 1/3   epeat                                   
 873::1177 2.1e-14 24.6% 0047335 00473352 2/3   epeat                                   
  34::600  2.4e-12 19.3% 0046912 00469121 1/3   epeat                                   
 874::1176 2.2e-11 21.2% 0050416 00504162 2/3   epeat                                   
  38::556  5.3e-11 20.7% 0038302 00383021 1/3   epeat                                   
 874::1137 6.6e-11 21.6% 0038302 00383022 2/3   epeat                                   
 855::1041 1.7e-10 22.6% 0045874 00458742 2/3   epeat                                   
1042::1988 9.5e-10 17.2% 0045874 00458743 3/3   epeat                                   
1257::2034 9.2e-09 14.9% 0049802 00498022 2/2   epeat                                   
 311::599  9.6e-08 17.6% 0048921 00489212 2/4   epeat                                   
  12::574  2.4e-07 23.0% 0050416 00504161 1/3   epeat                                   
  33::256    4e-07 20.1% 0050417 00504171 1/4   epeat                                   
1012::1981 7.5e-07 19.7% 0052026 00520262 2/2   epeat                                   
1047::1986 1.3e-06 19.3% 0042771 00427712 2/2   epeat                                   
  33::251  6.2e-06 20.5% 0048921 00489211 1/4   epeat                                   
 430::594  9.3e-06 21.6% 0050417 00504172 2/4   epeat                                   
  20::511  1.1e-05 18.7% 0047335 00473351 1/3   epeat                                   
1311::2024 1.2e-05 20.5% 0050417 00504174 4/4   epeat                                   
 897::1199 6.3e-05 26.2% 0051071 00510712 2/3   epeat                                   
 427::537  8.5e-05 28.7% 0051071 00510711 1/3   epeat                                   
1799::1991  0.0018 15.9% 0046912 00469123 3/3   epeat                                   
1871::1982  0.0046 22.1% 0038302 00383023 3/3   epeat                                   
 871::983   0.0067 26.5% 0048666 00486662 2/3   epeat                                   
1044::1175  0.0087 22.2% 0048666 00486663 3/3   epeat                                   
1794::1985   0.012 19.5% 0047075 00470753 3/3   epeat                                   
1082::1179   0.015 26.5% 0040642 00406423 3/3   itellin-phosvitin complex, superhelical 
1872::1991     0.1 21.7% 0051071 00510713 3/3   epeat                                   
1055::1325    0.16 20.7% 0043958 00439583 3/4   epeat                                   
1258::1985    0.19 16.1% 0047335 00473353 3/3   epeat                                   
  30::524     0.26 23.1% 0043958 00439581 1/4   epeat                                   
 874::1081    0.38 27.3% 0040642 00406422 2/3   itellin-phosvitin complex, superhelical 
1875::1982    0.59 23.5% 0050416 00504163 3/3   epeat                                   
 457::511     0.72 27.5% 0048666 00486661 1/3   epeat                                   
 881::1026     1.9 26.9% 0043958 00439582 2/4   epeat                                   
1553::2039     2.6 19.4% 0051023 00510232 2/2   epeat                                   
1256::2023     3.3 20.8% 0048921 00489214 4/4   epeat                                   
1837::1980      12 16.2% 0043958 00439584 4/4   epeat                                   
 459::526       18 26.6% 0040642 00406421 1/3   itellin-phosvitin complex, superhelical 
   1::2076


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MDETHSLLLNEEALEACPEQKRPVFIYEWLRYLDRILPITQREDLKNVQKELQQQLESRLHTVVGPPTRK
00498021   1/2  ----------asellaelleal.kskdpdvRlealqeLkkllkkgweelpeedlsellplllkllssp.d
00504173   3/4  ----------------------------------------------------------------------
00427711   1/2  ----------eqllqlLeallspdpevrkqaeeaLeqlaendlpdfllslleilsn.....ssldeevRq
00470752   2/3  ----------------------------------------------------------------------
00520261   1/2  --------------------------------------------------------------------rr
00510231   1/2  ----------------------------------------------------------------------
00489213   3/4  ----------------------------------------------------------------------
00469122   2/3  ----------------------------------------------------------------------
00470751   1/3  ------------------------gmrgladlikslrelksleeerkriskelaelrkllksdtpldpsk
00458741   1/3  -----------------------------laledeellelleellellkskdeevrlsalkaLaeliral
00473352   2/3  ----------------------------------------------------------------------
00469121   1/3  ---------------------------------ealgslinklgdpellpellplllellksk.deevrk
00504162   2/3  ----------------------------------------------------------------------
00383021   1/3  -------------------------------------keeeekrieeelaelrellksp.dpevrrealk
00383022   2/3  ----------------------------------------------------------------------
00458742   2/3  ----------------------------------------------------------------------
00458743   3/3  ----------------------------------------------------------------------
00498022   2/2  ----------------------------------------------------------------------
00489212   2/4  ----------------------------------------------------------------------
00504161   1/3  -----------mednarlknfknkekldleelrrkreefrveiRkkkreellkkkRnislndeeselled
00504171   1/4  --------------------------------Lgsllesleeafvtlqvlfpeelepylpellpallkll
00520262   2/2  ----------------------------------------------------------------------
00427712   2/2  ----------------------------------------------------------------------
00489211   1/4  --------------------------------Lsnllellp.evlspylpellpallkllkd.pdeevre
00504172   2/4  ----------------------------------------------------------------------
00473351   1/3  -------------------eelllkrrnvllqlsdllseleslldllesleelleellrllqspdpevrl
00504174   4/4  ----------------------------------------------------------------------
00510712   2/3  ----------------------------------------------------------------------
00510711   1/3  ----------------------------------------------------------------------
00469123   3/3  ----------------------------------------------------------------------
00383023   3/3  ----------------------------------------------------------------------
00486662   2/3  ----------------------------------------------------------------------
00486663   3/3  ----------------------------------------------------------------------
00470753   3/3  ----------------------------------------------------------------------
00406423   3/3  ----------------------------------------------------------------------
00510713   3/3  ----------------------------------------------------------------------
00439583   3/4  ----------------------------------------------------------------------
00473353   3/3  ----------------------------------------------------------------------
00439581   1/4  -----------------------------LkdpdpevrlaaalalgnlgdeavplLlell.sdedplvrr
00406422   2/3  ----------------------------------------------------------------------
00504163   3/3  ----------------------------------------------------------------------
00486661   1/3  ----------------------------------------------------------------------
00439582   2/4  ----------------------------------------------------------------------
00510232   2/2  ----------------------------------------------------------------------
00489214   4/4  ----------------------------------------------------------------------
00439584   4/4  ----------------------------------------------------------------------
00406421   1/3  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           LIARCIGRVYALTGDIVSLNTLLNSCNDTLKVKDESPKAVQSKLAALACLSAVYDSMGRMAGRSIEDTLA
00498021   1/2  pevrkaaalaLanlakklde.ellelllplLlkllsspd.....pevrelalraLasiakrlgpgaaspe
00504173   3/4  ----------------------------------------------------------------------
00427711   1/2  aaallLknlikklwpelleeladiwltlspeeleellslllkllkdp.dplvrl.aaealaaiarllgpe
00470752   2/3  ----------------------------------------------------------------------
00520261   1/2  aaadaldalasvlgd.eilplllpfllells....ss.nwrvreaallalgslaegtpeeklkpllpell
00510231   1/2  ----------------------------------------------------------------------
00489213   3/4  ----------------------------------------------------------------------
00469122   2/3  ----------------------------------------------------------------------
00470751   1/3  rlealkkllyllllg..edvs.ellpellkllssp.dpevrrlaylalselaeedpdllll..linlllk
00458741   1/3  gpeedlsellplllkllespdevrklallaLgellkllpelellelllplllkllkspdplvreaalral
00473352   2/3  ----------------------------------------------------------------------
00469121   1/3  kalealgelakklpdelllall.eellpaLlkllsspdpeevreaalralaklledlpprlalilegilp
00504162   2/3  ----------------------------------------------------------------------
00383021   1/3  kllylltlgedvsellpellkllsskdfevkrlaylalsllakenpellll..vinlllkdl..ndpnpe
00383022   2/3  ----------------------------------------------------------------------
00458742   2/3  ----------------------------------------------------------------------
00458743   3/3  ----------------------------------------------------------------------
00498022   2/2  ----------------------------------------------------------------------
00489212   2/4  ----------------------------------------------------------------------
00504161   1/3  lldlleeleddleelleelpellellnsedpevrlqalkaLgkllssekeelleeliesgllpllvkllk
00504171   1/4  s.dpseevreaaelenalealgtlvkalpdeltpyleellplllqllkellsddedpevrlaalealgsl
00520262   2/2  ----------------------------------------------------------------------
00427712   2/2  ----------------------------------------------------------------------
00489211   1/4  aalealgslasvlgedllqeelldkllplllellkd...lesdpelreaalealgsllkalgeeflplle
00504172   2/4  ----------------------------------------------------------------------
00473351   1/3  salkalgellslnndelaeliiesgllpallellsndpdpevrlaallaLgnlasgnpenleplleagal
00504174   4/4  ----------------------------------------------------------------------
00510712   2/3  ----------------------------------------------------------------------
00510711   1/3  ----------------------------------------------------------------------
00469123   3/3  ----------------------------------------------------------------------
00383023   3/3  ----------------------------------------------------------------------
00486662   2/3  ----------------------------------------------------------------------
00486663   3/3  ----------------------------------------------------------------------
00470753   3/3  ----------------------------------------------------------------------
00406423   3/3  ----------------------------------------------------------------------
00510713   3/3  ----------------------------------------------------------------------
00439583   3/4  ----------------------------------------------------------------------
00473353   3/3  ----------------------------------------------------------------------
00439581   1/4  aaaraLgnlgd...........................................................
00406422   2/3  ----------------------------------------------------------------------
00504163   3/3  ----------------------------------------------------------------------
00486661   1/3  ----------------------------------------------------------------------
00439582   2/4  ----------------------------------------------------------------------
00510232   2/2  ----------------------------------------------------------------------
00489214   4/4  ----------------------------------------------------------------------
00439584   4/4  ----------------------------------------------------------------------
00406421   1/3  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           IVKNWMSTAVAHSQAHIMNTLTSMVKALGSGDYVTHKKIHSIAKNSLQDRTLCKTPNVKIASLECLTALV
00498021   1/2  lveelldellplllsllksdkdpevreaallalakllknlpelleplledllplllkllsd....pdpev
00504173   3/4  ----------------------------------------------------------------------
00427711   1/2  dtwpellpellells.....sedgplevregallaLgelaeslsgelllsllpeilplllqllrsndpsp
00470752   2/3  ----------------------------------------------------------------------
00520261   1/2  plllsllkdpnpevreaalwaLgrlaedlpevldnlelleqllpallkllkd.....npevrraaasaLg
00510231   1/2  ----------------------------------------------------------------------
00489213   3/4  ----------------------------------------------------------------------
00469122   2/3  ----------------------------------------------------------------------
00470751   1/3  ll..kdpdpev...reaAlraLgkladke......lleellpillellssldpdpsvRkaAalaLgnlae
00458741   1/3  gsllellpppelledllplllkllkdk.....dpkvrkaalealgkllellpelllpellplllkllsdp
00473352   2/3  ----------------------------------------------------------------------
00469121   1/3  lllkllkdpdpevrraaaraLgnlasgdpellealveagllplLlklLsdp....dpevreaaaeaLgnl
00504162   2/3  ----------------------------------------------------------------------
00383021   1/3  vralAlraLgni.........gdpelledllpallkllsdpnpyvRkaaalalgklak..lnpdlvkdpg
00383022   2/3  ----------------------------------------------------------------------
00458742   2/3  ----------------------------------------------------------------------
00458743   3/3  ----------------------------------------------------------------------
00498022   2/2  ----------------------------------------------------------------------
00489212   2/4  ----------------------------------------------------------------------
00504161   1/3  spdpeevrlaalkaLgnlasg.spellealleqgilplLlklLsd.pdpevreaalraLgnlasdspelr
00504171   1/4  akalgpeilspllekllplllellededpevreaalkllsslleklp.efspylpellplllells....
00520262   2/2  ----------------------------------------------------------------------
00427712   2/2  ----------------------------------------------------------------------
00489211   1/4  kliplllellsslldedededeeddeeddddselregallllstllkalgeeflpylpqsellplllell
00504172   2/4  ----------------------------------------------------------------------
00473351   1/3  paLlelLs.dpdpevreaalraLgnlakdspelrdalleagilppLlellknlllsdpdpevreaaasal
00504174   4/4  ----------------------------------------------------------------------
00510712   2/3  ----------------------------------------------------------------------
00510711   1/3  ----------------------------------------------------------------------
00469123   3/3  ----------------------------------------------------------------------
00383023   3/3  ----------------------------------------------------------------------
00486662   2/3  ----------------------------------------------------------------------
00486663   3/3  ----------------------------------------------------------------------
00470753   3/3  ----------------------------------------------------------------------
00406423   3/3  ----------------------------------------------------------------------
00510713   3/3  ----------------------------------------------------------------------
00439583   3/4  ----------------------------------------------------------------------
00473353   3/3  ----------------------------------------------------------------------
00439581   1/4  ......................................................................
00406422   2/3  ----------------------------------------------------------------------
00504163   3/3  ----------------------------------------------------------------------
00486661   1/3  ----------------------------------------------------------------------
00439582   2/4  ----------------------------------------------------------------------
00510232   2/2  ----------------------------------------------------------------------
00489214   4/4  ----------------------------------------------------------------------
00439584   4/4  ----------------------------------------------------------------------
00406421   1/3  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           QFHTPIYTTELEASCTMCIKILEGSTYELRCAVAKFTAQLLATSMKPPPGAVIKAKSNQTVPVRPASVTD
00498021   1/2  RkaAaealgallkklpdel...leellpallellkedpdpevrkaalelLgellesnpel..........
00504173   3/4  ----------------------------------------------------------------------
00427711   1/2  evrlaalkalaslleslpsn.eeledlldsllplll.kllkdpdpevreaalealgellellpdllrpyl
00470752   2/3  ----------------------------------------------------------------------
00520261   1/2  nllelldplseedl........................................................
00510231   1/2  ----------------------------------------------------------------------
00489213   3/4  ----------------------------------------------------------------------
00469122   2/3  ----------------------------------------------------------------------
00470751   1/3  glpdllklv..gllplllklLndp....dpeVreaaleaLgnlakdspellkpllegllplLlkllsdpd
00458741   1/3  dpevrkaaleaLgellknlpeeelleellplllellkd.........pdpevrlaalkaLgalleglpe.
00473352   2/3  ----------------------------------------------------------------------
00469121   1/3  aedspelrdplleegllpaLlkllkdpddpevrraaleaLgnla..snpelreelvlp............
00504162   2/3  ----------------------------------------------------------------------
00383021   1/3  llpllvelLsdp....dpsvreaalsaLgelaednpesvllellkgliplLlellndpdpevreaaleal
00383022   2/3  ----------------------------------------------------------------------
00458742   2/3  ----------------------------------------------------------------------
00458743   3/3  ----------------------------------------------------------------------
00498022   2/2  ----------------------------------------------------------------------
00489212   2/4  ----------------------------------------------------------------------
00504161   1/3  dplleegllpallkllk....de.dpevrrnaleaLgnlcrgleplddleyvegllplLlellkd.....
00504171   1/4  dedpevreaalealgalilklpeef.pyleqllplllkllsdedpd------------------------
00520262   2/2  ----------------------------------------------------------------------
00427712   2/2  ----------------------------------------------------------------------
00489211   1/4  kde....spevreaalkllgdllealpeelspyleellpll-----------------------------
00504172   2/4  ----------------------------------------------------------------------
00473351   1/3  anlardaeprkdapylegllpiLlellkdpdpevreaaleaLgnlaegdpeniellveagllpllvells
00504174   4/4  ----------------------------------------------------------------------
00510712   2/3  ----------------------------------------------------------------------
00510711   1/3  ----------------------------------------------------------------------
00469123   3/3  ----------------------------------------------------------------------
00383023   3/3  ----------------------------------------------------------------------
00486662   2/3  ----------------------------------------------------------------------
00486663   3/3  ----------------------------------------------------------------------
00470753   3/3  ----------------------------------------------------------------------
00406423   3/3  ----------------------------------------------------------------------
00510713   3/3  ----------------------------------------------------------------------
00439583   3/4  ----------------------------------------------------------------------
00473353   3/3  ----------------------------------------------------------------------
00439581   1/4  ......................................................................
00406422   2/3  ----------------------------------------------------------------------
00504163   3/3  ----------------------------------------------------------------------
00486661   1/3  ----------------------------------------------------------------------
00439582   2/4  ----------------------------------------------------------------------
00510232   2/2  ----------------------------------------------------------------------
00489214   4/4  ----------------------------------------------------------------------
00439584   4/4  ----------------------------------------------------------------------
00406421   1/3  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           TLNLLASGFLRGGIGGFLKGSSSTFSTMGRSDIRIGVSICYVEMVREMGSAWLEKHLIAVCCHMVDLASK
00498021   1/2  ......................................................................
00504173   3/4  ----------------------------------------------------------------------
00427711   1/2  edgllplllkllkdpdpevrlaaleflstlakalpkllke..............................
00470752   2/3  ----------------------------------------------------------------------
00520261   1/2  ......................................................................
00510231   1/2  ----------------------------------------------------------------------
00489213   3/4  ----------------------------------------------------------------------
00469122   2/3  ----------------------------------------------------------------------
00470751   1/3  peesdydysgvpspwvreaaleaLgnlaegi.......................................
00458741   1/3  .epllpkllplllellsdpspevraaalkalgkllsnlppei..llekllplllellkdp....dpevre
00473352   2/3  ----------------------------------------------------------------------
00469121   1/3  ......................................................................
00504162   2/3  ----------------------------------------------------------------------
00383021   1/3  gklarsd...............................................................
00383022   2/3  ----------------------------------------------------------------------
00458742   2/3  ----------------------------------------------------------------------
00458743   3/3  ----------------------------------------------------------------------
00498022   2/2  ----------------------------------------------------------------------
00489212   2/4  ------------------------------pelreaalealgsllkalgee.flpllekliplllellss
00504161   1/3  ........................................pdpevreaaleaLgnlaesnpeliealies
00504171   1/4  ----------------------------------------------------------------------
00520262   2/2  ----------------------------------------------------------------------
00427712   2/2  ----------------------------------------------------------------------
00489211   1/4  ----------------------------------------------------------------------
00504172   2/4  ----------------------------------------------------------------------
00473351   1/3  ds....dpevreaalraLgnlasgspelleplldlgllplllkllsdpdpevreaalkaLgnlaa.....
00504174   4/4  ----------------------------------------------------------------------
00510712   2/3  ----------------------------------------------------------------------
00510711   1/3  ----------------------------------------------------------------------
00469123   3/3  ----------------------------------------------------------------------
00383023   3/3  ----------------------------------------------------------------------
00486662   2/3  ----------------------------------------------------------------------
00486663   3/3  ----------------------------------------------------------------------
00470753   3/3  ----------------------------------------------------------------------
00406423   3/3  ----------------------------------------------------------------------
00510713   3/3  ----------------------------------------------------------------------
00439583   3/4  ----------------------------------------------------------------------
00473353   3/3  ----------------------------------------------------------------------
00439581   1/4  ......................................................................
00406422   2/3  ----------------------------------------------------------------------
00504163   3/3  ----------------------------------------------------------------------
00486661   1/3  ----------------------------------------------------------------------
00439582   2/4  ----------------------------------------------------------------------
00510232   2/2  ----------------------------------------------------------------------
00489214   4/4  ----------------------------------------------------------------------
00439584   4/4  ----------------------------------------------------------------------
00406421   1/3  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           CGHLAYTQNASHVSEALTIRRCISFILRQTIGSLLGENAQTLACKHLGVLLSQYVDLVSIGTGDNLDSSV
00498021   1/2  ......................................................................
00504173   3/4  ----------------------------------------------------------------------
00427711   1/2  ......................................................................
00470752   2/3  ----------------------------------------------------------------------
00520261   1/2  ......................................................................
00510231   1/2  ----------------------------------------------------------------------
00489213   3/4  ----------------------------------------------------------------------
00469122   2/3  ----------------------------------------------------------------------
00470751   1/3  ......................................................................
00458741   1/3  aaleaLgslleslpellspelyleellplllellsdpdpevreaalealgklakllg.............
00473352   2/3  ----------------------------------------------------------------------
00469121   1/3  ......................................................................
00504162   2/3  ----------------------------------------------------------------------
00383021   1/3  ......................................................................
00383022   2/3  ----------------------------------------------------------------------
00458742   2/3  ----------------------------------------------------------------------
00458743   3/3  ----------------------------------------------------------------------
00498022   2/2  ----------------------------------------------------------------------
00489212   2/4  lld..........................................................edededeed
00504161   1/3  gilplllellksedeevreaalraLg............................................
00504171   1/4  ----------------------------------------------------------------------
00520262   2/2  ----------------------------------------------------------------------
00427712   2/2  ----------------------------------------------------------------------
00489211   1/4  ----------------------------------------------------------------------
00504172   2/4  ----------------------------------------------------------------------
00473351   1/3  ......................................................................
00504174   4/4  ----------------------------------------------------------------------
00510712   2/3  ----------------------------------------------------------------------
00510711   1/3  ----------------------------------------------------------------------
00469123   3/3  ----------------------------------------------------------------------
00383023   3/3  ----------------------------------------------------------------------
00486662   2/3  ----------------------------------------------------------------------
00486663   3/3  ----------------------------------------------------------------------
00470753   3/3  ----------------------------------------------------------------------
00406423   3/3  ----------------------------------------------------------------------
00510713   3/3  ----------------------------------------------------------------------
00439583   3/4  ----------------------------------------------------------------------
00473353   3/3  ----------------------------------------------------------------------
00439581   1/4  ......................................................................
00406422   2/3  ----------------------------------------------------------------------
00504163   3/3  ----------------------------------------------------------------------
00486661   1/3  ----------------------------------------------------------------------
00439582   2/4  ----------------------------------------------------------------------
00510232   2/2  ----------------------------------------------------------------------
00489214   4/4  ----------------------------------------------------------------------
00439584   4/4  ----------------------------------------------------------------------
00406421   1/3  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           DSSDYGSGYAIIVILQEISVLVRQIGTSVMSLFTEATGIMEHIFKCLTHPLASARYAAAWCLRCIATAVP
00498021   1/2  ............................................lksllpellplllkllsdpdpevrla
00504173   3/4  ----------------------------------------------------------------------
00427711   1/2  .................................................................eedpe
00470752   2/3  ----------------------------------------------------------------------
00520261   1/2  ...................................epyleellpiLlkllkkqdpdpevreaalealssl
00510231   1/2  --------------------------------------llgleellelLqspdpevrlaallaLgklslg
00489213   3/4  ----------------------------------------------------------------------
00469122   2/3  ----------------------------------------------------------------------
00470751   1/3  .....................dpelleplleellplLl...............................k
00458741   1/3  ......................................................................
00473352   2/3  ----------------------------------------------------------------------
00469121   1/3  ........................................gllpvLlkllkdpdpevreaalkaLgnlls
00504162   2/3  ----------------------------------------------------------------------
00383021   1/3  .................................................................peele
00383022   2/3  ----------------------------------------------------------------------
00458742   2/3  ----------------------------------------------------------------------
00458743   3/3  ----------------------------------------------------------------------
00498022   2/2  ----------------------------------------------------------------------
00489212   2/4  deeddddselregallllstllkalgeeflpylpqsellplllellkdespevreaalkllgdllealpe
00504161   1/3  ......................................................................
00504171   1/4  ----------------------------------------------------------------------
00520262   2/2  ----------------------------------------------------------------------
00427712   2/2  ----------------------------------------------------------------------
00489211   1/4  ----------------------------------------------------------------------
00504172   2/4  ---------lllellkdgnvpnplvraaalealgrlaevlgpefleellplllklLsdsdpevreaAara
00473351   1/3  ......................................................................
00504174   4/4  ----------------------------------------------------------------------
00510712   2/3  ----------------------------------------------------------------------
00510711   1/3  ------pellkellkslevdaellelllellqsdedeevrlaalraLrnla..edpdnaealiel.gglp
00469123   3/3  ----------------------------------------------------------------------
00383023   3/3  ----------------------------------------------------------------------
00486662   2/3  ----------------------------------------------------------------------
00486663   3/3  ----------------------------------------------------------------------
00470753   3/3  ----------------------------------------------------------------------
00406423   3/3  ----------------------------------------------------------------------
00510713   3/3  ----------------------------------------------------------------------
00439583   3/4  ----------------------------------------------------------------------
00473353   3/3  ----------------------------------------------------------------------
00439581   1/4  ....................................eealplllellededplvrraAaeaLgnlgd...
00406422   2/3  ----------------------------------------------------------------------
00504163   3/3  ----------------------------------------------------------------------
00486661   1/3  ------------------------------------lkllrleaayalgeigdpgavplLlellkdedpe
00439582   2/4  ----------------------------------------------------------------------
00510232   2/2  ----------------------------------------------------------------------
00489214   4/4  ----------------------------------------------------------------------
00439584   4/4  ----------------------------------------------------------------------
00406421   1/3  --------------------------------------llpallellksslvdpdpylrkaaalalgslv


                         *         -         -         -         -         +         -:560
query           NLMTPLIDRCLPRLDQLSSSSRAISGFSMALSALLAASTDSSKLGIPYAKPLKVLDLAEEMLRTSTQQPK
00498021   1/2  alellsalaellpellkpllekllpallkllssdpdpevrkealdaleelledlpddlelliklledldd
00504173   3/4  ----------------------------------------------------------------------
00427711   1/2  lldlieeilppllaegllellvplldeeleeddddeddddeslrkaaaealgrlakllgeevlelllpll
00470752   2/3  ----------------------------------------------------------------------
00520261   1/2  ikalgeeiepyleellplllellskllsellnyvseldsdedpelraaalrllgnllskl...geqfqpl
00510231   1/2  neellellielgliplLlelLkdpdpevrlaaaraLgnlaegnpenrealveagalpaLlelLssdpdpe
00489213   3/4  ----------------------------------------------------------------------
00469122   2/3  ----------------------------------------------------------------------
00470751   1/3  llsstddskvlanss-------------------------------------------------------
00458741   1/3  ..........................neelaeellplLlkllkde..dpevreaalealgdllkklglpp
00473352   2/3  ----------------------------------------------------------------------
00469121   1/3  vlpe..qplieellplLlkllsdpd.pevreaalraLgnlakgdpegleplle.agllplLlelLknsdp
00504162   2/3  ----------------------------------------------------------------------
00383021   1/3  kllplllkllsdpnpavrlealkalgnllenpkal.eelidellelLlkilellsds.dpevryaa----
00383022   2/3  ----------------------------------------------------------------------
00458742   2/3  ----------------------------------------------------------------------
00458743   3/3  ----------------------------------------------------------------------
00498022   2/2  ----------------------------------------------------------------------
00489212   2/4  elspyleellplllellndpdpevrqaalsalgalalklgetlepylelllplllelledpeenpdvren
00504161   1/3  ......................................................................
00504171   1/4  ----------------------------------------------------------------------
00520262   2/2  ----------------------------------------------------------------------
00427712   2/2  ----------------------------------------------------------------------
00489211   1/4  ----------------------------------------------------------------------
00504172   2/4  Lgsllesleeafvtlqvlfpeelepylpellpallklls.dpseevreaaelenalealgtlvkalpdel
00473351   1/3  .....................-------------------------------------------------
00504174   4/4  ----------------------------------------------------------------------
00510712   2/3  ----------------------------------------------------------------------
00510711   1/3  lLleklLkspdpevreaAaraLgnlasgnpenrealveagalplLlq-----------------------
00469123   3/3  ----------------------------------------------------------------------
00383023   3/3  ----------------------------------------------------------------------
00486662   2/3  ----------------------------------------------------------------------
00486663   3/3  ----------------------------------------------------------------------
00470753   3/3  ----------------------------------------------------------------------
00406423   3/3  ----------------------------------------------------------------------
00510713   3/3  ----------------------------------------------------------------------
00439583   3/4  ----------------------------------------------------------------------
00473353   3/3  ----------------------------------------------------------------------
00439581   1/4  .......pealplLlell.kdededvrlaaalaL------------------------------------
00406422   2/3  ----------------------------------------------------------------------
00504163   3/3  ----------------------------------------------------------------------
00486661   1/3  vrlaaakaLgeigdpealpll-------------------------------------------------
00439582   2/4  ----------------------------------------------------------------------
00510232   2/2  ----------------------------------------------------------------------
00489214   4/4  ----------------------------------------------------------------------
00439584   4/4  ----------------------------------------------------------------------
00406421   1/3  rkycvhtsscleelvkaivplLiellsd....sded----------------------------------


                         -         -         -         *         -         -         -:630
query           LTIAKLESGWNLIYALIHLGPSVMKEHLPRVIKLWKAAFARSAKEAESENSRGDAFSWQCAMIAQAGALS
00498021   1/2  ddpnvrraalealgklakllpelllpfleellpallellsdpdpevreaalealgslaellgpdlledll
00504173   3/4  ----------------------------------------------------------------------
00427711   1/2  lkllsspdwrvReaallalgsiaeglpedllspllpellpallqllndpnp.rvraaalwalgrlaskls
00470752   2/3  ----------------------------------------------------------------------
00520261   1/2  le..dllplllells.ssdddsvreealealsnlakalgelfspyleqllplllell.............
00510231   1/2  vreaalraLgnla.sspelrdalle..galpaLldll.................................
00489213   3/4  ----------------------------------------------------------------------
00469122   2/3  ----------------------------------------------------------------------
00470751   1/3  ----------------------------------------------------------------------
00458741   1/3  lle.ellplllelledpdpevreaalellgelasllg........-------------------------
00473352   2/3  ----------------------------------------------------------------------
00469121   1/3  dpevrkealwaLgnlaaglppseelrlalllegllpaLle------------------------------
00504162   2/3  ----------------------------------------------------------------------
00383021   1/3  ----------------------------------------------------------------------
00383022   2/3  ----------------------------------------------------------------------
00458742   2/3  ----------------------------------------------------------------------
00458743   3/3  ----------------------------------------------------------------------
00498022   2/2  ----------------------------------------------------------------------
00489212   2/4  alkllgrlllklpelllpylpll..lpallsal......-------------------------------
00504161   1/3  ...........nla--------------------------------------------------------
00504171   1/4  ----------------------------------------------------------------------
00520262   2/2  ----------------------------------------------------------------------
00427712   2/2  ----------------------------------------------------------------------
00489211   1/4  ----------------------------------------------------------------------
00504172   2/4  tpylee..llplllqllkellsddedpevrlaal------------------------------------
00473351   1/3  ----------------------------------------------------------------------
00504174   4/4  ----------------------------------------------------------------------
00510712   2/3  ----------------------------------------------------------------------
00510711   1/3  ----------------------------------------------------------------------
00469123   3/3  ----------------------------------------------------------------------
00383023   3/3  ----------------------------------------------------------------------
00486662   2/3  ----------------------------------------------------------------------
00486663   3/3  ----------------------------------------------------------------------
00470753   3/3  ----------------------------------------------------------------------
00406423   3/3  ----------------------------------------------------------------------
00510713   3/3  ----------------------------------------------------------------------
00439583   3/4  ----------------------------------------------------------------------
00473353   3/3  ----------------------------------------------------------------------
00439581   1/4  ----------------------------------------------------------------------
00406422   2/3  ----------------------------------------------------------------------
00504163   3/3  ----------------------------------------------------------------------
00486661   1/3  ----------------------------------------------------------------------
00439582   2/4  ----------------------------------------------------------------------
00510232   2/2  ----------------------------------------------------------------------
00489214   4/4  ----------------------------------------------------------------------
00439584   4/4  ----------------------------------------------------------------------
00406421   1/3  ----------------------------------------------------------------------


                         -         +         -         -         -         -         *:700
query           VMEAVASQPELSSTNNALDAMKVPIECSLVMMSQVGNLIKSYGNEMRQANSVVRIRLYRLLLLLPHKSFE
00498021   1/2  pellsl...........................................................lesls
00504173   3/4  ----------------------------------------------------------------------
00427711   1/2  peglppeflkqllplLlellkd.sp.....rvrsaaasaLgnllellgeeksavieagelptsvlspylp
00470752   2/3  ----------------------------------------------------------------------
00520261   1/2  ......................................................................
00510231   1/2  ......................................................................
00489213   3/4  ----------------------------------------------------------------------
00469122   2/3  ----------------------------------------------------------------------
00470751   1/3  ----------------------------------------------------------------------
00458741   1/3  ----------------------------------------------------------------------
00473352   2/3  ----------------------------------------------------------------------
00469121   1/3  ----------------------------------------------------------------------
00504162   2/3  ----------------------------------------------------------------------
00383021   1/3  ----------------------------------------------------------------------
00383022   2/3  ----------------------------------------------------------------------
00458742   2/3  ----------------------------------------------------------------------
00458743   3/3  ----------------------------------------------------------------------
00498022   2/2  ----------------------------------------------------------------------
00489212   2/4  ----------------------------------------------------------------------
00504161   1/3  ----------------------------------------------------------------------
00504171   1/4  ----------------------------------------------------------------------
00520262   2/2  ----------------------------------------------------------------------
00427712   2/2  ----------------------------------------------------------------------
00489211   1/4  ----------------------------------------------------------------------
00504172   2/4  ----------------------------------------------------------------------
00473351   1/3  ----------------------------------------------------------------------
00504174   4/4  ----------------------------------------------------------------------
00510712   2/3  ----------------------------------------------------------------------
00510711   1/3  ----------------------------------------------------------------------
00469123   3/3  ----------------------------------------------------------------------
00383023   3/3  ----------------------------------------------------------------------
00486662   2/3  ----------------------------------------------------------------------
00486663   3/3  ----------------------------------------------------------------------
00470753   3/3  ----------------------------------------------------------------------
00406423   3/3  ----------------------------------------------------------------------
00510713   3/3  ----------------------------------------------------------------------
00439583   3/4  ----------------------------------------------------------------------
00473353   3/3  ----------------------------------------------------------------------
00439581   1/4  ----------------------------------------------------------------------
00406422   2/3  ----------------------------------------------------------------------
00504163   3/3  ----------------------------------------------------------------------
00486661   1/3  ----------------------------------------------------------------------
00439582   2/4  ----------------------------------------------------------------------
00510232   2/2  ----------------------------------------------------------------------
00489214   4/4  ----------------------------------------------------------------------
00439584   4/4  ----------------------------------------------------------------------
00406421   1/3  ----------------------------------------------------------------------


                         -         -         -         -         +         -         -:770
query           GSYAALLRELVADITLSDNSQSTLTTSLPISQFTGVEKILISPVYDATDYSMVEDLLQTPISSVSLGNIE
00498021   1/2  elleelleellplLlellndespevreaalkalgrlaeklpelleeylekllplllellsdedpse....
00504173   3/4  ----------------------------------------------------------------------
00427711   1/2  ellpaLlell....srysdenpevreaalea.......................................
00470752   2/3  ----------------------------------------------------------------------
00520261   1/2  ......................................................................
00510231   1/2  ......................................................................
00489213   3/4  ----------------------------------------------------------------------
00469122   2/3  ----------------------------------------------------------------------
00470751   1/3  ----------------------------------------------------------------------
00458741   1/3  ----------------------------------------------------------------------
00473352   2/3  ----------------------------------------------------------------------
00469121   1/3  ----------------------------------------------------------------------
00504162   2/3  ----------------------------------------------------------------------
00383021   1/3  ----------------------------------------------------------------------
00383022   2/3  ----------------------------------------------------------------------
00458742   2/3  ----------------------------------------------------------------------
00458743   3/3  ----------------------------------------------------------------------
00498022   2/2  ----------------------------------------------------------------------
00489212   2/4  ----------------------------------------------------------------------
00504161   1/3  ----------------------------------------------------------------------
00504171   1/4  ----------------------------------------------------------------------
00520262   2/2  ----------------------------------------------------------------------
00427712   2/2  ----------------------------------------------------------------------
00489211   1/4  ----------------------------------------------------------------------
00504172   2/4  ----------------------------------------------------------------------
00473351   1/3  ----------------------------------------------------------------------
00504174   4/4  ----------------------------------------------------------------------
00510712   2/3  ----------------------------------------------------------------------
00510711   1/3  ----------------------------------------------------------------------
00469123   3/3  ----------------------------------------------------------------------
00383023   3/3  ----------------------------------------------------------------------
00486662   2/3  ----------------------------------------------------------------------
00486663   3/3  ----------------------------------------------------------------------
00470753   3/3  ----------------------------------------------------------------------
00406423   3/3  ----------------------------------------------------------------------
00510713   3/3  ----------------------------------------------------------------------
00439583   3/4  ----------------------------------------------------------------------
00473353   3/3  ----------------------------------------------------------------------
00439581   1/4  ----------------------------------------------------------------------
00406422   2/3  ----------------------------------------------------------------------
00504163   3/3  ----------------------------------------------------------------------
00486661   1/3  ----------------------------------------------------------------------
00439582   2/4  ----------------------------------------------------------------------
00510232   2/2  ----------------------------------------------------------------------
00489214   4/4  ----------------------------------------------------------------------
00439584   4/4  ----------------------------------------------------------------------
00406421   1/3  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:840
query           EDLSNLIRASASQIGDTWPENDSEPLTCLNTALLTYGKVFPLVNNKHKVQITEHFWDTIQKSKNAGRKQA
00498021   1/2  ......................................................................
00504173   3/4  ----------------------------------------------------------------------
00427711   1/2  ......................................................................
00470752   2/3  ----------------------------------------------------------------------
00520261   1/2  ......................................................................
00510231   1/2  ......................................................................
00489213   3/4  ----------------------------------------------------------------------
00469122   2/3  ------------------------------------------ealgslinklgdpellpellplllellk
00470751   1/3  ----------------------------------------------------------------------
00458741   1/3  ----------------------------------------------------------------------
00473352   2/3  ----------------------------------------------------------------------
00469121   1/3  ----------------------------------------------------------------------
00504162   2/3  ----------------------------------------------------------------------
00383021   1/3  ----------------------------------------------------------------------
00383022   2/3  ----------------------------------------------------------------------
00458742   2/3  ----------------------------------------------------------------------
00458743   3/3  ----------------------------------------------------------------------
00498022   2/2  ----------------------------------------------------------------------
00489212   2/4  ----------------------------------------------------------------------
00504161   1/3  ----------------------------------------------------------------------
00504171   1/4  ----------------------------------------------------------------------
00520262   2/2  ----------------------------------------------------------------------
00427712   2/2  ----------------------------------------------------------------------
00489211   1/4  ----------------------------------------------------------------------
00504172   2/4  ----------------------------------------------------------------------
00473351   1/3  ----------------------------------------------------------------------
00504174   4/4  ----------------------------------------------------------------------
00510712   2/3  ----------------------------------------------------------------------
00510711   1/3  ----------------------------------------------------------------------
00469123   3/3  ----------------------------------------------------------------------
00383023   3/3  ----------------------------------------------------------------------
00486662   2/3  ----------------------------------------------------------------------
00486663   3/3  ----------------------------------------------------------------------
00470753   3/3  ----------------------------------------------------------------------
00406423   3/3  ----------------------------------------------------------------------
00510713   3/3  ----------------------------------------------------------------------
00439583   3/4  ----------------------------------------------------------------------
00473353   3/3  ----------------------------------------------------------------------
00439581   1/4  ----------------------------------------------------------------------
00406422   2/3  ----------------------------------------------------------------------
00504163   3/3  ----------------------------------------------------------------------
00486661   1/3  ----------------------------------------------------------------------
00439582   2/4  ----------------------------------------------------------------------
00510232   2/2  ----------------------------------------------------------------------
00489214   4/4  ----------------------------------------------------------------------
00439584   4/4  ----------------------------------------------------------------------
00406421   1/3  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:910
query           ILVNALTAKLLSYKTLCEQRGHKLDNETLQRASFDLISSSLSNSCPMTRLVGAEALARLSQAVNSPPFVA
00498021   1/2  .evreaalsalgellenlspellvpyledlleallkllsd.eneevrlaa....lkalgkllkvlgeslp
00504173   3/4  ---------llalgslaqkegl.peegsteksdlvpllp.qllplllellkdgnvpnplvraaalealgr
00427711   1/2  ......................................................................
00470752   2/3  ----------------------gmrgladlikslrelksleeerkriskelaelrkllksdtpldpskrl
00520261   1/2  ...............................................................sdddeev
00510231   1/2  ......................................................................
00489213   3/4  ---------------------------------lpallkllkdpdeevreaalealgslasvlgedllqe
00469122   2/3  skdeevrkkalealgelakklpdelllalleellpaLlkllsspdpeevreaalralaklledlpprlal
00470751   1/3  ----------------------------------------------------------------------
00458741   1/3  ----------------------------------------------------------------------
00473352   2/3  --------------------------------eelllkrrnvllqlsdllseleslldllesleelleel
00469121   1/3  ----------------------------------------------------------------------
00504162   2/3  ---------------------------------mednarlknfknkekldleelrrkreefrveiRkkkr
00383021   1/3  ----------------------------------------------------------------------
00383022   2/3  ---------------------------------lelLlkilellsdsdpevryaalraLgklaks..lpe
00458742   2/3  --------------slleslpellspelyleellplllellsdpdpevreaalealgklakllgneelae
00458743   3/3  ----------------------------------------------------------------------
00498022   2/2  ----------------------------------------------------------------------
00489212   2/4  ----------------------------------------------------------------------
00504161   1/3  ----------------------------------------------------------------------
00504171   1/4  ----------------------------------------------------------------------
00520262   2/2  ----------------------------------------------------------------------
00427712   2/2  ----------------------------------------------------------------------
00489211   1/4  ----------------------------------------------------------------------
00504172   2/4  ----------------------------------------------------------------------
00473351   1/3  ----------------------------------------------------------------------
00504174   4/4  ----------------------------------------------------------------------
00510712   2/3  --------------------------------------------------------pellkellkslevd
00510711   1/3  ----------------------------------------------------------------------
00469123   3/3  ----------------------------------------------------------------------
00383023   3/3  ----------------------------------------------------------------------
00486662   2/3  ------------------------------lkllrleaayalgeigdpgavplLlellkdedpevrlaaa
00486663   3/3  ----------------------------------------------------------------------
00470753   3/3  ----------------------------------------------------------------------
00406423   3/3  ----------------------------------------------------------------------
00510713   3/3  ----------------------------------------------------------------------
00439583   3/4  ----------------------------------------------------------------------
00473353   3/3  ----------------------------------------------------------------------
00439581   1/4  ----------------------------------------------------------------------
00406422   2/3  ---------------------------------lellksslvdpdpylrkaaalalgslvrkycvhtssc
00504163   3/3  ----------------------------------------------------------------------
00486661   1/3  ----------------------------------------------------------------------
00439582   2/4  ----------------------------------------Lkdpdpevrlaaalalgnl.....gdeavp
00510232   2/2  ----------------------------------------------------------------------
00489214   4/4  ----------------------------------------------------------------------
00439584   4/4  ----------------------------------------------------------------------
00406421   1/3  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:980
query           SIAQYCFDKLNSCKDEINRSGHVLALGCLHRHVGSLGSGQHLNTGVSVVLALAEESKMPKVQTCALVAMA
00498021   1/2  eseelfkplldellplllelledksddpevreaaleaLgllakalgelfspyleellpllldil...edp
00504173   3/4  laevl.gpefleellplllklL.sdsdpevreaAaraLgsllesleeafvtlqvlfpeelepylpellpa
00427711   1/2  ...........................................................lgelvsvsged
00470752   2/3  ealkkllyllllgedvsellpellkllsspdpevrrlaylalselaeedpdllll.linlllkllkdpdp
00520261   1/2  reaalellgnlleklgeellpylegllplllsllespdvspevrqaalsllgdlaeklpell.spyldel
00510231   1/2  lepllglleklldelskssdpevrraaleaLanlss...npenrealvelegalpaLlkllkseeedddl
00489213   3/4  elldkllplllellkdlesdpelreaalealgsllkalgeeflpllekliplllellsslldedededee
00469122   2/3  ileg...........ilplllkllkdpdpevrraaaraLgnlasgdpellealveagllplLlklLs.dp
00470751   1/3  ----------------------------------------------------------------------
00458741   1/3  ----------------------------------------------------------------------
00473352   2/3  lrllqspdpevrlsalkalgellslnndelaeliiesgllpallellsndpdpevrlaallaLgnlasgn
00469121   1/3  ----------------------------------------------------------------------
00504162   2/3  eellkkkRnislndeeselledlldlleeleddleelleelpellellnsedpevrlqalkaLgklls.s
00383021   1/3  ----------------------------------------------------------------------
00383022   2/3  lvlpylp.llellkdddlsvrlealellsklv........neenleeilkeLlellsdp.dpevreealr
00458742   2/3  ellplLlkllkde.dpevreaalealgdllkklg...lpplleellplllelled.pdpevreaalellg
00458743   3/3  ----------------------------------------------------------------------
00498022   2/2  ----------------------------------------------------------------------
00489212   2/4  ----------------------------------------------------------------------
00504161   1/3  ----------------------------------------------------------------------
00504171   1/4  ----------------------------------------------------------------------
00520262   2/2  ----------------------------------------------------------------------
00427712   2/2  ----------------------------------------------------------------------
00489211   1/4  ----------------------------------------------------------------------
00504172   2/4  ----------------------------------------------------------------------
00473351   1/3  ----------------------------------------------------------------------
00504174   4/4  ----------------------------------------------------------------------
00510712   2/3  aellelllellqs..de.deevrlaalraLrnlaedpdnaealielgglplLleklLksp.dpevreaAa
00510711   1/3  ----------------------------------------------------------------------
00469123   3/3  ----------------------------------------------------------------------
00383023   3/3  ----------------------------------------------------------------------
00486662   2/3  kaLgeigdpealplliellkdedeevreaaaealgriakdlglfddallpllilllsdedpsvrraaaea
00486663   3/3  ----------------------------------------------------------------------
00470753   3/3  ----------------------------------------------------------------------
00406423   3/3  ----------------------------------------------------------------------
00510713   3/3  ----------------------------------------------------------------------
00439583   3/4  ----------------------------------------------------------------------
00473353   3/3  ----------------------------------------------------------------------
00439581   1/4  ----------------------------------------------------------------------
00406422   2/3  l.eelvkaivplLiellsd.sdedvrllalkaLgnl.......ghpeslpvllplLpgllsl........
00504163   3/3  ----------------------------------------------------------------------
00486661   1/3  ----------------------------------------------------------------------
00439582   2/4  lLlellsde.....dplvrraaaraLgnl...........gdeealplllell.ededplvrraAaeaLg
00510232   2/2  ----------------------------------------------------------------------
00489214   4/4  ----------------------------------------------------------------------
00439584   4/4  ----------------------------------------------------------------------
00406421   1/3  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:1050
query           LIAETGSGMFRVFVETTLSSCLKLLISTPTFVVDVVQGISKCLTALITCVGPELSCPGVIDGVRTSLLAA
00498021   1/2  evreealkaLgdlaellpeklfpplldkllplllkllkds.dpevrlaaleaLgdlllslgeeflepyle
00504173   3/4  llkllsdps.eevreaaelenalealgtlvkalpdeltpyleellplllqllkellsddedpevrlaale
00427711   1/2  llpyidellplllellsdllqkskallelalkdedpelrkaalealgllaaalgp---------------
00470752   2/3  evreaAlraLgkla....dkelleellpillellssld.pdpsvRkaAalaLgnlaeglpdllklv...g
00520261   1/2  lpillellsnepdlddedeldedpevr-------------------------------------------
00510231   1/2  dpevreaalsaLsnlaydlpeevdenpenleelllegllpalllellkdsd.pevreaalralgnlasgs
00489213   3/4  ddeeddddselregallllstllkalg.eeflpylpqsellplllellk.despevreaalkllgdllea
00469122   2/3  dpevreaaaeaLgnlaed.spelrdplleegllpaLlkllkdpddpevrraaleaLgnlasnpelreelv
00470751   1/3  ----------------------------------------------------------------------
00458741   1/3  ----------------------------------------------------------------------
00473352   2/3  penleplleagalpaLlelLsdpdpevreaalraLgnlakdspelrdalleagilppLlellknlllsdp
00469121   1/3  ----------------------------------------------------------------------
00504162   2/3  ekeelleeliesgllpllvkllkspdpeevrlaalkaLgnlasgspellealleqgilplLlklLs.dpd
00383021   1/3  ----------------------------------------------------------------------
00383022   2/3  algelasklppdf....eqllplllkllsde...dpevrlaalealgnllekvp..........ellepv
00458742   2/3  elasllg..lkpflpellplllkllsdp...spevreaalealgkllrklpeepyleellp---------
00458743   3/3  -------------------------------------------------------------laledeell
00498022   2/2  ----------------------------------------------------------------------
00489212   2/4  ----------------------------------------------------------------------
00504161   1/3  ----------------------------------------------------------------------
00504171   1/4  ----------------------------------------------------------------------
00520262   2/2  -------------------------------PmdleqllqlLqallspdnevrkqAeeqLkeleknnppe
00427712   2/2  ------------------------------------------------------------------ilpl
00489211   1/4  ----------------------------------------------------------------------
00504172   2/4  ----------------------------------------------------------------------
00473351   1/3  ----------------------------------------------------------------------
00504174   4/4  ----------------------------------------------------------------------
00510712   2/3  raLgnlasgnpenrealveagalplLlqlLs.......................................
00510711   1/3  ----------------------------------------------------------------------
00469123   3/3  ----------------------------------------------------------------------
00383023   3/3  ----------------------------------------------------------------------
00486662   2/3  lgn-------------------------------------------------------------------
00486663   3/3  ---------------------------------------------------------------lkllrle
00470753   3/3  ----------------------------------------------------------------------
00406423   3/3  ----------------------------------------------------------------------
00510713   3/3  ----------------------------------------------------------------------
00439583   3/4  ----------------------------------------------------------------------
00473353   3/3  ----------------------------------------------------------------------
00439581   1/4  ----------------------------------------------------------------------
00406422   2/3  ......................................................................
00504163   3/3  ----------------------------------------------------------------------
00486661   1/3  ----------------------------------------------------------------------
00439582   2/4  nlgd...........pealplLlellkde..dedvrlaaalaLgnl------------------------
00510232   2/2  ----------------------------------------------------------------------
00489214   4/4  ----------------------------------------------------------------------
00439584   4/4  ----------------------------------------------------------------------
00406421   1/3  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:1120
query           CAIQLSHSDPFVQAEAISGLQQMHLFAPRYVHMAQLVVDISSLLSSTHLVIRRQSVSCLRQLVQRESKEV
00498021   1/2  ellplllkll...edpdpevreaalealgelleklgeelv.pylpq.....llplllerlsdpelddelr
00504173   3/4  algslakalgpei.lspllekllplllelle....dedpevreaalkllsslleklp.efspylpellpl
00427711   1/2  ----------------------------------------------------------------------
00470752   2/3  llplllklLn.dpdpeVreaaleaLgnlakdspellkpllegllplLlkllsd.pdpeesdydysgvpsp
00520261   1/2  ----------------------------------------------------------------------
00510231   1/2  pelaeelle...lgvlplllel..............................................le
00489213   3/4  lpeelspyleellplllell.ndp..dpevrqaalsalgalalklgetl..epylelllplllelle...
00469122   2/3  lpgllpvLlkllkdp...dpevreaalkaLgnllsvlpe........qplieellplLlkllsdpdpevr
00470751   1/3  ----------------------------------------------------------------------
00458741   1/3  ----------------------------------------------------------------------
00473352   2/3  dpevreaaasalanlardaeprkdapylegllpiLlell.kdpdpevreaaleaLgnlaegdpeniellv
00469121   1/3  ----------------------------------------------------------------------
00504162   2/3  pevreaalraLgnlasdspelrdplleegllpallkllkde...dpevrrnaleaLgnlcrgleplddle
00383021   1/3  ----------------------------------------------------------------------
00383022   2/3  lpallelledsespevrraaawalgelaellpe...ledilplLlellkdedpevreaalsalaklllkl
00458742   2/3  ----------------------------------------------------------------------
00458743   3/3  elleellellkskdeevrlsalkaLaeliralgpeedlsellplllkllespdevrklallaLgellkll
00498022   2/2  ----------------------------------------------------------------------
00489212   2/4  ----------------------------------------------------------------------
00504161   1/3  ----------------------------------------------------------------------
00504171   1/4  ----------------------------------------------------------------------
00520262   2/2  fllllleilldsssdpeiRqlAailLknllkknwrptddefaerlwpaldeeekeqiknlllqlllepdp
00427712   2/2  llqllrsndpspevrlaalkalaslleslpsneeledlldsllplllkllkdpdpevreaalealgelle
00489211   1/4  ----------------------------------------------------------------------
00504172   2/4  ----------------------------------------------------------------------
00473351   1/3  ----------------------------------------------------------------------
00504174   4/4  ----------------------------------------------------------------------
00510712   2/3  ..........sspdpevreaalwaLgnlardspearealleagglpaLlellkspdpkvrrnaawaLsnl
00510711   1/3  ----------------------------------------------------------------------
00469123   3/3  ----------------------------------------------------------------------
00383023   3/3  ----------------------------------------------------------------------
00486662   2/3  ----------------------------------------------------------------------
00486663   3/3  aayalgeigdpgavplLlellkdedpevrlaaakaLgeigdpealplliellkdedeevreaaaealgri
00470753   3/3  ----------------------------------------------------------------------
00406423   3/3  -------------------------------vllplLpgllsllddpslrvRlaAvlaLrnlaehlprkv
00510713   3/3  ----------------------------------------------------------------------
00439583   3/4  ----Lkdpdpevrlaaalalgnl.........gdeavplLlellsdedplvrraaaraLgnlgd......
00473353   3/3  ----------------------------------------------------------------------
00439581   1/4  ----------------------------------------------------------------------
00406422   2/3  ...........lddpslrvRlaAvlaLrnla---------------------------------------
00504163   3/3  ----------------------------------------------------------------------
00486661   1/3  ----------------------------------------------------------------------
00439582   2/4  ----------------------------------------------------------------------
00510232   2/2  ----------------------------------------------------------------------
00489214   4/4  ----------------------------------------------------------------------
00439584   4/4  ----------------------------------------------------------------------
00406421   1/3  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:1190
query           RNHAQVLVPQGIVDTNKKKFALPESGLEGALFGMLDTEVNKELRCHLQETLISLVQGTSGELLNNWLMLS
00498021   1/2  elalkclarllllipgivdlesllekllkllesiedeeekkdalrgllkllkdnpkellqel--------
00504173   3/4  llellsdedpevreaalealgalilklpeef.pyleqllplllkllsdedpdvralellgklikklppel
00427711   1/2  ----------------------------------------------------------------------
00470752   2/3  wvreaaleaLgnlaegi-----------------------------------------------------
00520261   1/2  ----------------------------------------------------------------------
00510231   1/2  ssedpevreaalgaLgnla.rsepnrlkllealilkeegilplLlellssedpevre-------------
00489213   3/4  dpeenpdvrenalkllgrlllklpelllpylplllpallsalddledpevrkaallalgellklnpelvl
00469122   2/3  eaalraLgnlakgdpegleplleagllplLlelLknsdpdpevr--------------------------
00470751   1/3  ----------------------------------------------------------------------
00458741   1/3  ----------------------------------------------------------------------
00473352   2/3  eagllpllvellsds...dpevreaalraLgnlasgs......pelleplldlgllp-------------
00469121   1/3  ----------------------------------------------------------------------
00504162   2/3  yvegllplLlellkdpdpevreaaleaLgnlaesnpeliealiesgilplllellk--------------
00383021   1/3  ----------------------------------------------------------------------
00383022   2/3  peelkplllqllellln-----------------------------------------------------
00458742   2/3  ----------------------------------------------------------------------
00458743   3/3  pelellelllplllkllkspdplvreaalralgsllellpppelledllplllkllkdkdpkvrkaalea
00498022   2/2  ----------------------------------------------------------------------
00489212   2/4  ----------------------------------------------------------------------
00504161   1/3  ----------------------------------------------------------------------
00504171   1/4  ----------------------------------------------------------------------
00520262   2/2  lvrsaaaealaaiaridlpeglwpellplllellkspsdpelreaallalselleelrel......lqei
00427712   2/2  llpdllrpyled...................gllplllkllkdp.dpevrlaaleflstlakalpkllke
00489211   1/4  ----------------------------------------------------------------------
00504172   2/4  ----------------------------------------------------------------------
00473351   1/3  ----------------------------------------------------------------------
00504174   4/4  ----------------------------------------------------------------------
00510712   2/3  asgd...................pelrealveagalpaLvellssp.dpevreaaleaLanlad.sseel
00510711   1/3  ----------------------------------------------------------------------
00469123   3/3  ----------------------------------------------------------------------
00383023   3/3  ----------------------------------------------------------------------
00486662   2/3  ----------------------------------------------------------------------
00486663   3/3  akdlglfddallpllilllsdedpsvrraaaealgnlgdnfp..elveealplll---------------
00470753   3/3  ----------------------------------------------------------------------
00406423   3/3  qdvllpllldtaedpevRiaAvlaLmetnpsaallqalaellgkepnlqvrsfvlsalk-----------
00510713   3/3  ----------------------------------------------------------------------
00439583   3/4  ......................................................................
00473353   3/3  ----------------------------------------------------------------------
00439581   1/4  ----------------------------------------------------------------------
00406422   2/3  ----------------------------------------------------------------------
00504163   3/3  ----------------------------------------------------------------------
00486661   1/3  ----------------------------------------------------------------------
00439582   2/4  ----------------------------------------------------------------------
00510232   2/2  ----------------------------------------------------------------------
00489214   4/4  ----------------------------------------------------------------------
00439584   4/4  ----------------------------------------------------------------------
00406421   1/3  ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:1260
query           KEILATSNDHGLVRKKEEKKDRGEDDADDDDDEDGDDDTNLAGISSLMEEDKGKVQPRWPTKVFTMEIVN
00498021   1/2  ----------------------------------------------------------------------
00504173   3/4  ldpyl....esilpallerltsdedpevrrsalellgrlllllgpdlllplleslqe-------------
00427711   1/2  ----------------------------------------------------------------------
00470752   2/3  ----------------------------------------------------------------------
00520261   1/2  ----------------------------------------------------------------------
00510231   1/2  ----------------------------------------------------------------------
00489213   3/4  efl....................peilpallkll..dpdp------------------------------
00469122   2/3  ----------------------------------------------------------------------
00470751   1/3  ----------------------------------------------------------------------
00458741   1/3  ----------------------------------------------------------------------
00473352   2/3  ----------------------------------------------------------------------
00469121   1/3  ----------------------------------------------------------------------
00504162   2/3  ----------------------------------------------------------------------
00383021   1/3  ----------------------------------------------------------------------
00383022   2/3  ----------------------------------------------------------------------
00458742   2/3  ----------------------------------------------------------------------
00458743   3/3  lgkllellpelll.......................pellplllklls.dpdpevrkaaleaLgellknl
00498022   2/2  ------------------------------------------------------------------asel
00489212   2/4  ----------------------------------------------------------------------
00504161   1/3  ----------------------------------------------------------------------
00504171   1/4  ----------------------------------------------------------------------
00520262   2/2  leellplllkllevllssdpspevrlaalkalgsllrsldsslefeelldqilelllellsdedeevrka
00427712   2/2  eedpelldlieeilppllaegllellvpllde..................eleeddddeddddeslrkaa
00489211   1/4  ----------------------------------------------------------------------
00504172   2/4  ----------------------------------------------------------------------
00473351   1/3  ----------------------------------------------------------------------
00504174   4/4  ----------------------------------------------------------------------
00510712   2/3  aelllelll-------------------------------------------------------------
00510711   1/3  ----------------------------------------------------------------------
00469123   3/3  ----------------------------------------------------------------------
00383023   3/3  ----------------------------------------------------------------------
00486662   2/3  ----------------------------------------------------------------------
00486663   3/3  ----------------------------------------------------------------------
00470753   3/3  ----------------------------------------------------------------------
00406423   3/3  ----------------------------------------------------------------------
00510713   3/3  ----------------------------------------------------------------------
00439583   3/4  .................................................................eealp
00473353   3/3  -------------------------------------------------------------------eel
00439581   1/4  ----------------------------------------------------------------------
00406422   2/3  ----------------------------------------------------------------------
00504163   3/3  ----------------------------------------------------------------------
00486661   1/3  ----------------------------------------------------------------------
00439582   2/4  ----------------------------------------------------------------------
00510232   2/2  ----------------------------------------------------------------------
00489214   4/4  -----------------------------------------------------------------Medel
00439584   4/4  ----------------------------------------------------------------------
00406421   1/3  ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:1330
query           RLMSVCDTERAHLDMALAKELQITSAGKNDYLVLHLSDLVRMSFMAATSDNSLLRIAGLKSLEEVIIRFS
00498021   1/2  ----------------------------------------------------------------------
00504173   3/4  ----------------------------------------------------------------------
00427711   1/2  ----------------------------------------------------------------------
00470752   2/3  ----------------------------------------------------------------------
00520261   1/2  ----------------------------------------------------------------------
00510231   1/2  ----------------------------------------------------------------------
00489213   3/4  ----------------------------------------------------------------------
00469122   2/3  ----------------------------------------------------------------------
00470751   1/3  ----------------------------------------------------------------------
00458741   1/3  ----------------------------------------------------------------------
00473352   2/3  ----------------------------------------------------------------------
00469121   1/3  ----------------------------------------------------------------------
00504162   2/3  ----------------------------------------------------------------------
00383021   1/3  ----------------------------------------------------------------------
00383022   2/3  ----------------------------------------------------------------------
00458742   2/3  ----------------------------------------------------------------------
00458743   3/3  pe....................................................................
00498022   2/2  laellealkskdpdvRlealqeLkkllkkgweelpeedlsellplllkllsspdpevrkaaalaLanlak
00489212   2/4  ----------------------------------------------------------------------
00504161   1/3  ----------------------------------------------------------------------
00504171   1/4  ----------------------------------------------------------------------
00520262   2/2  alkcLgrllelypelllpylekllelllkllsk...................de.dpevrlaaleflssl
00427712   2/2  aeal.....grlakllgeevlel.llplllkllsspdwrvReaallalgsiaeglpedllspllpellpa
00489211   1/4  ----------------------------------------------------------------------
00504172   2/4  ----------------------------------------------------------------------
00473351   1/3  ----------------------------------------------------------------------
00504174   4/4  --------------------------------------------------Mddleqllqllyaspdpevr
00510712   2/3  ----------------------------------------------------------------------
00510711   1/3  ----------------------------------------------------------------------
00469123   3/3  ----------------------------------------------------------------------
00383023   3/3  ----------------------------------------------------------------------
00486662   2/3  ----------------------------------------------------------------------
00486663   3/3  ----------------------------------------------------------------------
00470753   3/3  ----------------------------------------------------------------------
00406423   3/3  ----------------------------------------------------------------------
00510713   3/3  ----------------------------------------------------------------------
00439583   3/4  lllellededplvrraAaeaLgnlgd..........pealplLlellkdededvrlaaalaLgnl-----
00473353   3/3  llkrrnvllqlsdllseleslldllesleelleellrllqspdpevrlsalkalgellslnndelaelii
00439581   1/4  ----------------------------------------------------------------------
00406422   2/3  ----------------------------------------------------------------------
00504163   3/3  ----------------------------------------------------------------------
00486661   1/3  ----------------------------------------------------------------------
00439582   2/4  ----------------------------------------------------------------------
00510232   2/2  ----------------------------------------------------------------------
00489214   4/4  dpldlqqllqlLeallspdnevrkqAeeqLkqlekspdfllllleiladlesldlevrqlAavlLknlik
00439584   4/4  ----------------------------------------------------------------------
00406421   1/3  ----------------------------------------------------------------------


                         -         +         -         -         -         -         *:1400
query           SCPEPEFPGHMILEQFQAQVGAALRPAFTDDTPSNVTSVACQVCSTWIGSGVARDLSDLKRVHQLLVSSL
00498021   1/2  ----------------------------------------------------------------------
00504173   3/4  ----------------------------------------------------------------------
00427711   1/2  ----------------------------------------------------------------------
00470752   2/3  ----------------------------------------------------------------------
00520261   1/2  ----------------------------------------------------------------------
00510231   1/2  ----------------------------------------------------------------------
00489213   3/4  ----------------------------------------------------------------------
00469122   2/3  ----------------------------------------------------------------------
00470751   1/3  ----------------------------------------------------------------------
00458741   1/3  ----------------------------------------------------------------------
00473352   2/3  ----------------------------------------------------------------------
00469121   1/3  ----------------------------------------------------------------------
00504162   2/3  ----------------------------------------------------------------------
00383021   1/3  ----------------------------------------------------------------------
00383022   2/3  ----------------------------------------------------------------------
00458742   2/3  ----------------------------------------------------------------------
00458743   3/3  ............................................eelleellplllellkdpdpevrlaa
00498022   2/2  kldeellelllplLlkllsspdpevrelalraLasiakrlgpgaaspelveelldellplllsllksdkd
00489212   2/4  ----------------------------------------------------------------------
00504161   1/3  ----------------------------------------------------------------------
00504171   1/4  ----------------------------------------------------------------------
00520262   2/2  aksegkillkaledkkeerrspellkpyleelvpvl...........lkllsdddededddewsvrraaa
00427712   2/2  llqllndpnprvraaalwal....grlask....lspeglppeflkqllplLlellkd..sprvrsaaas
00489211   1/4  ----------------------------------------------------------------------
00504172   2/4  ----------------------------------------------------------------------
00473351   1/3  ----------------------------------------------------------------------
00504174   4/4  kqAeeqLeqlqkspefllllleilssssldpevrffAailLknlikknwssled...nnalpeeekeeik
00510712   2/3  ----------------------------------------------------------------------
00510711   1/3  ----------------------------------------------------------------------
00469123   3/3  ----------------------------------------------------------------------
00383023   3/3  ----------------------------------------------------------------------
00486662   2/3  ----------------------------------------------------------------------
00486663   3/3  ----------------------------------------------------------------------
00470753   3/3  ----------------------------------------------------------------------
00406423   3/3  ----------------------------------------------------------------------
00510713   3/3  ----------------------------------------------------------------------
00439583   3/4  ----------------------------------------------------------------------
00473353   3/3  esgllpallellsndpdpevrlaallaLgnlasgnpenleplleagalpaLlelLsdpdpevreaalraL
00439581   1/4  ----------------------------------------------------------------------
00406422   2/3  ----------------------------------------------------------------------
00504163   3/3  ----------------------------------------------------------------------
00486661   1/3  ----------------------------------------------------------------------
00439582   2/4  ----------------------------------------------------------------------
00510232   2/2  ----------------------------------------------------------------------
00489214   4/4  knwpslpeeekeeikelllellkdpdplvrnqaaealaaiarkdgpeewpellpellellsssdeelreg
00439584   4/4  ----------------------------------------------------------------------
00406421   1/3  ----------------------------------------------------------------------


                         -         -         -         -         +         -         -:1470
query           NKLKHGSINVQLYSESAATLEKLSILKAWAEVYVTAIEQDRMKNENVEARDHYDYNGSGSLLSLVEPEAN
00498021   1/2  ----------------------------------------------------------------------
00504173   3/4  ----------------------------------------------------------------------
00427711   1/2  ----------------------------------------------------------------------
00470752   2/3  ----------------------------------------------------------------------
00520261   1/2  ----------------------------------------------------------------------
00510231   1/2  ----------------------------------------------------------------------
00489213   3/4  ----------------------------------------------------------------------
00469122   2/3  ----------------------------------------------------------------------
00470751   1/3  ----------------------------------------------------------------------
00458741   1/3  ----------------------------------------------------------------------
00473352   2/3  ----------------------------------------------------------------------
00469121   1/3  ----------------------------------------------------------------------
00504162   2/3  ----------------------------------------------------------------------
00383021   1/3  ----------------------------------------------------------------------
00383022   2/3  ----------------------------------------------------------------------
00458742   2/3  ----------------------------------------------------------------------
00458743   3/3  lkaLgalleglpe............epllpkllplllell.sdpspevraaalkalgkllsnlppei..l
00498022   2/2  pevreaallalakllknlpelleplledllplllkllsdpdpevRkaAaealgallkklpdel.......
00489212   2/4  ----------------------------------------------------------------------
00504161   1/3  ----------------------------------------------------------------------
00504171   1/4  ----------------------------------------------------------------------
00520262   2/2  daldalasvlgdeilp.........lllpfllellsssnwrvreaallalgslaegtpeeklkpllpell
00427712   2/2  aLgnllellgeeksavieagelptsvlspy..lpellpaLlellsrysdenpevreaalea.........
00489211   1/4  ----------------------------------------------------------------------
00504172   2/4  ----------------------------------------------------------------------
00473351   1/3  ----------------------------------------------------------------------
00504174   4/4  nsllqll.idspplvrnklaqalaeiakr.........................................
00510712   2/3  ----------------------------------------------------------------------
00510711   1/3  ----------------------------------------------------------------------
00469123   3/3  ----------------------------------------------------------------------
00383023   3/3  ----------------------------------------------------------------------
00486662   2/3  ----------------------------------------------------------------------
00486663   3/3  ----------------------------------------------------------------------
00470753   3/3  ----------------------------------------------------------------------
00406423   3/3  ----------------------------------------------------------------------
00510713   3/3  ----------------------------------------------------------------------
00439583   3/4  ----------------------------------------------------------------------
00473353   3/3  gnlakdsp...................................................elrdalleagi
00439581   1/4  ----------------------------------------------------------------------
00406422   2/3  ----------------------------------------------------------------------
00504163   3/3  ----------------------------------------------------------------------
00486661   1/3  ----------------------------------------------------------------------
00439582   2/4  ----------------------------------------------------------------------
00510232   2/2  ----------------------------------------------------------------------
00489214   4/4  allaLgelleelgslsesdalqelleeilplllkllsdpdpevrkaalkalgnlasflpeefedllnell
00439584   4/4  ----------------------------------------------------------------------
00406421   1/3  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:1540
query           SLIAYWLAMLNDSALLALPAHYSDQFLNRGGAFFNAHSAEACREYYQICWPPILLACSTWLSKNNFELPS
00498021   1/2  ----------------------------------------------------------------------
00504173   3/4  ----------------------------------------------------------------------
00427711   1/2  ----------------------------------------------------------------------
00470752   2/3  ----------------------------------------------------------------------
00520261   1/2  ----------------------------------------------------------------------
00510231   1/2  ----------------------------------------------------------------------
00489213   3/4  ----------------------------------------------------------------------
00469122   2/3  ----------------------------------------------------------------------
00470751   1/3  ----------------------------------------------------------------------
00458741   1/3  ----------------------------------------------------------------------
00473352   2/3  ----------------------------------------------------------------------
00469121   1/3  ----------------------------------------------------------------------
00504162   2/3  ----------------------------------------------------------------------
00383021   1/3  ----------------------------------------------------------------------
00383022   2/3  ----------------------------------------------------------------------
00458742   2/3  ----------------------------------------------------------------------
00458743   3/3  lekllplllellk.....dpdpevreaaleaLgslleslpellspely......................
00498022   2/2  ......leellpallellkedpdpevrkaalelLgellesnpellksllpellplllklls.....dpdp
00489212   2/4  ----------------------------------------------------------------------
00504161   1/3  ----------------------------------------------------------------------
00504171   1/4  ----------------------------------------------------------------------
00520262   2/2  plllsllkdpnpevreaalwaLgrlaedlpevld....................................
00427712   2/2  ......................................................................
00489211   1/4  ----------------------------------------------------------------------
00504172   2/4  ----------------------------------------------------------------------
00473351   1/3  ----------------------------------------------------------------------
00504174   4/4  ......................................................................
00510712   2/3  ----------------------------------------------------------------------
00510711   1/3  ----------------------------------------------------------------------
00469123   3/3  ----------------------------------------------------------------------
00383023   3/3  ----------------------------------------------------------------------
00486662   2/3  ----------------------------------------------------------------------
00486663   3/3  ----------------------------------------------------------------------
00470753   3/3  ----------------------------------------------------------------------
00406423   3/3  ----------------------------------------------------------------------
00510713   3/3  ----------------------------------------------------------------------
00439583   3/4  ----------------------------------------------------------------------
00473353   3/3  lppLlellknlllsdpdpevreaaasalanl.......................................
00439581   1/4  ----------------------------------------------------------------------
00406422   2/3  ----------------------------------------------------------------------
00504163   3/3  ----------------------------------------------------------------------
00486661   1/3  ----------------------------------------------------------------------
00439582   2/4  ----------------------------------------------------------------------
00510232   2/2  ----------------------------------------------------------------------
00489214   4/4  plllellsspdpkvrkaalealgelaerypd.......................................
00439584   4/4  ----------------------------------------------------------------------
00406421   1/3  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:1610
query           GIELSSETAAVWRDEGNVSRFYLLIGIAVESLSNKTRQIEDETIQMSVKSLTRLLSCEWCQLHLMSDVPA
00498021   1/2  ----------------------------------------------------------------------
00504173   3/4  ----------------------------------------------------------------------
00427711   1/2  ----------------------------------------------------------------------
00470752   2/3  ----------------------------------------------------------------------
00520261   1/2  ----------------------------------------------------------------------
00510231   1/2  ----------------------------------------------------------------------
00489213   3/4  ----------------------------------------------------------------------
00469122   2/3  ----------------------------------------------------------------------
00470751   1/3  ----------------------------------------------------------------------
00458741   1/3  ----------------------------------------------------------------------
00473352   2/3  ----------------------------------------------------------------------
00469121   1/3  ----------------------------------------------------------------------
00504162   2/3  ----------------------------------------------------------------------
00383021   1/3  ----------------------------------------------------------------------
00383022   2/3  ----------------------------------------------------------------------
00458742   2/3  ----------------------------------------------------------------------
00458743   3/3  ......................................................................
00498022   2/2  evrlaalellsalaellpellkpllekllpallkllssdpdpevrkealdaleelledlpdd........
00489212   2/4  ----------------------------------------------------------------------
00504161   1/3  ----------------------------------------------------------------------
00504171   1/4  ----------------------------------------------------------------------
00520262   2/2  ..............nlelleqllpallkllk.....d.npevrraaasaLgnllelldplseedl.....
00427712   2/2  ......................................................................
00489211   1/4  ----------------------------------------------------------------------
00504172   2/4  ----------------------------------------------------------------------
00473351   1/3  ----------------------------------------------------------------------
00504174   4/4  .......................dfpeewpellpdllqllqspnpelrega...................
00510712   2/3  ----------------------------------------------------------------------
00510711   1/3  ----------------------------------------------------------------------
00469123   3/3  ----------------------------------------------------------------------
00383023   3/3  ----------------------------------------------------------------------
00486662   2/3  ----------------------------------------------------------------------
00486663   3/3  ----------------------------------------------------------------------
00470753   3/3  ----------------------------------------------------------------------
00406423   3/3  ----------------------------------------------------------------------
00510713   3/3  ----------------------------------------------------------------------
00439583   3/4  ----------------------------------------------------------------------
00473353   3/3  ......................................................................
00439581   1/4  ----------------------------------------------------------------------
00406422   2/3  ----------------------------------------------------------------------
00504163   3/3  ----------------------------------------------------------------------
00486661   1/3  ----------------------------------------------------------------------
00439582   2/4  ----------------------------------------------------------------------
00510232   2/2  ------------llgleellelLqspdpevrlaallaLgklslgneellellielgliplLlelLkdp..
00489214   4/4  ......................................................................
00439584   4/4  ----------------------------------------------------------------------
00406421   1/3  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:1680
query           VIEILYVLHRSVLTRDCLSTQLQCIECVGSIIDAAQLAIRICASRDISNGNLESEDTLRKIPNVLFAGEE
00498021   1/2  ----------------------------------------------------------------------
00504173   3/4  ----------------------------------------------------------------------
00427711   1/2  ----------------------------------------------------------------------
00470752   2/3  ----------------------------------------------------------------------
00520261   1/2  ----------------------------------------------------------------------
00510231   1/2  ----------------------------------------------------------------------
00489213   3/4  ----------------------------------------------------------------------
00469122   2/3  ----------------------------------------------------------------------
00470751   1/3  ----------------------------------------------------------------------
00458741   1/3  ----------------------------------------------------------------------
00473352   2/3  ----------------------------------------------------------------------
00469121   1/3  ----------------------------------------------------------------------
00504162   2/3  ----------------------------------------------------------------------
00383021   1/3  ----------------------------------------------------------------------
00383022   2/3  ----------------------------------------------------------------------
00458742   2/3  ----------------------------------------------------------------------
00458743   3/3  ......................................................................
00498022   2/2  ......................................................................
00489212   2/4  ----------------------------------------------------------------------
00504161   1/3  ----------------------------------------------------------------------
00504171   1/4  ----------------------------------------------------------------------
00520262   2/2  ......................................................................
00427712   2/2  ......................................................................
00489211   1/4  ----------------------------------------------------------------------
00504172   2/4  ----------------------------------------------------------------------
00473351   1/3  ----------------------------------------------------------------------
00504174   4/4  ......................................................................
00510712   2/3  ----------------------------------------------------------------------
00510711   1/3  ----------------------------------------------------------------------
00469123   3/3  ----------------------------------------------------------------------
00383023   3/3  ----------------------------------------------------------------------
00486662   2/3  ----------------------------------------------------------------------
00486663   3/3  ----------------------------------------------------------------------
00470753   3/3  ----------------------------------------------------------------------
00406423   3/3  ----------------------------------------------------------------------
00510713   3/3  ----------------------------------------------------------------------
00439583   3/4  ----------------------------------------------------------------------
00473353   3/3  ...................................................................ard
00439581   1/4  ----------------------------------------------------------------------
00406422   2/3  ----------------------------------------------------------------------
00504163   3/3  ----------------------------------------------------------------------
00486661   1/3  ----------------------------------------------------------------------
00439582   2/4  ----------------------------------------------------------------------
00510232   2/2  ..dpevrlaaaraLgnlaegnpenrealveagalpaLlelLss.......dpdpevreaalraLgnl...
00489214   4/4  ......................................................................
00439584   4/4  ----------------------------------------------------------------------
00406421   1/3  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:1750
query           GGKDGNINKDGVKTISYAILELAVCAIFKQMPQINSAQLKTNSLAALHLRKVGRLPAEGTHLVIKSMQIL
00498021   1/2  ----------------------------------------------------------------------
00504173   3/4  ----------------------------------------------------------------------
00427711   1/2  ----------------------------------------------------------------------
00470752   2/3  ----------------------------------------------------------------------
00520261   1/2  ----------------------------------------------------------------------
00510231   1/2  ----------------------------------------------------------------------
00489213   3/4  ----------------------------------------------------------------------
00469122   2/3  ----------------------------------------------------------------------
00470751   1/3  ----------------------------------------------------------------------
00458741   1/3  ----------------------------------------------------------------------
00473352   2/3  ----------------------------------------------------------------------
00469121   1/3  ----------------------------------------------------------------------
00504162   2/3  ----------------------------------------------------------------------
00383021   1/3  ----------------------------------------------------------------------
00383022   2/3  ----------------------------------------------------------------------
00458742   2/3  ----------------------------------------------------------------------
00458743   3/3  ......................................................................
00498022   2/2  ..............................................lelliklledl.ddddpnvrraal
00489212   2/4  ----------------------------------------------------------------------
00504161   1/3  ----------------------------------------------------------------------
00504171   1/4  ----------------------------------------------------------------------
00520262   2/2  ......................................................epyleellpiLlkllk
00427712   2/2  ......................................................................
00489211   1/4  ----------------------------------------------------------------------
00504172   2/4  ----------------------------------------------------------------------
00473351   1/3  ----------------------------------------------------------------------
00504174   4/4  ......................................................................
00510712   2/3  ----------------------------------------------------------------------
00510711   1/3  ----------------------------------------------------------------------
00469123   3/3  ----------------------------------------------------------------------
00383023   3/3  ----------------------------------------------------------------------
00486662   2/3  ----------------------------------------------------------------------
00486663   3/3  ----------------------------------------------------------------------
00470753   3/3  ----------------------------------------------------------------------
00406423   3/3  ----------------------------------------------------------------------
00510713   3/3  ----------------------------------------------------------------------
00439583   3/4  ----------------------------------------------------------------------
00473353   3/3  aeprkdapylegllpiLlellkdpd.pevreaaleaLgnlaeg...........................
00439581   1/4  ----------------------------------------------------------------------
00406422   2/3  ----------------------------------------------------------------------
00504163   3/3  ----------------------------------------------------------------------
00486661   1/3  ----------------------------------------------------------------------
00439582   2/4  ----------------------------------------------------------------------
00510232   2/2  ......................................................................
00489214   4/4  .................................................flkpylpdllplllklledkd
00439584   4/4  ----------------------------------------------------------------------
00406421   1/3  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:1820
query           VQIPSLCSPHSRVTVLPVIMYLLLGFVRESARLDEGSIQTDRAGHLSAIAAAAIQSIRSIVSQQPDDDTA
00498021   1/2  ----------------------------------------------------------------------
00504173   3/4  ----------------------------------------------------------------------
00427711   1/2  ----------------------------------------------------------------------
00470752   2/3  ----------------------------------------------------------------------
00520261   1/2  ----------------------------------------------------------------------
00510231   1/2  ----------------------------------------------------------------------
00489213   3/4  ----------------------------------------------------------------------
00469122   2/3  ----------------------------------------------------------------------
00470751   1/3  ----------------------------------------------------------------------
00458741   1/3  ----------------------------------------------------------------------
00473352   2/3  ----------------------------------------------------------------------
00469121   1/3  ----------------------------------------------------------------------
00504162   2/3  ----------------------------------------------------------------------
00383021   1/3  ----------------------------------------------------------------------
00383022   2/3  ----------------------------------------------------------------------
00458742   2/3  ----------------------------------------------------------------------
00458743   3/3  ......................................................................
00498022   2/2  ealgklakllpelllpfleellpallel....lsdpdpevreaalealgslaellgpdlledllpellsl
00489212   2/4  ----------------------------------------------------------------------
00504161   1/3  ----------------------------------------------------------------------
00504171   1/4  ----------------------------------------------------------------------
00520262   2/2  kqdpdpevreaalealsslikalgeeiepyleellplllellskllsellnyvselds....dedpelra
00427712   2/2  ...........................................lgelvsvsgedllp.yidellplllel
00489211   1/4  ----------------------------------------------------------------------
00504172   2/4  ----------------------------------------------------------------------
00473351   1/3  ----------------------------------------------------------------------
00504174   4/4  ...........................lliLkelveelrdlllsdelqkrrklllelleedlpeilplll
00510712   2/3  ----------------------------------------------------------------------
00510711   1/3  ----------------------------------------------------------------------
00469123   3/3  ------------------------------------------------ealgslinklgdpellpellpl
00383023   3/3  ----------------------------------------------------------------------
00486662   2/3  ----------------------------------------------------------------------
00486663   3/3  ----------------------------------------------------------------------
00470753   3/3  -------------------------------------------gmrgladlikslrelksleeerkrisk
00406423   3/3  ----------------------------------------------------------------------
00510713   3/3  ----------------------------------------------------------------------
00439583   3/4  ----------------------------------------------------------------------
00473353   3/3  ......................................................................
00439581   1/4  ----------------------------------------------------------------------
00406422   2/3  ----------------------------------------------------------------------
00504163   3/3  ----------------------------------------------------------------------
00486661   1/3  ----------------------------------------------------------------------
00439582   2/4  ----------------------------------------------------------------------
00510232   2/2  ...................................a.sspelrdalle.galpaLldll...........
00489214   4/4  pevrlaaleflstlakqkllpkll...epyleellplll.kllsldpedlelweddpeeyvrdededsde
00439584   4/4  ----------------------------------------------------------------------
00406421   1/3  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:1890
query           VSWKTIMRNAFYSVLNMSEDNERIQLDKCIIMVTAVVFTTSAPVDVVLGHQESFNKLIVLLKRHLQSDNV
00498021   1/2  ----------------------------------------------------------------------
00504173   3/4  ----------------------------------------------------------------------
00427711   1/2  ----------------------------------------------------------------------
00470752   2/3  ----------------------------------------------------------------------
00520261   1/2  ----------------------------------------------------------------------
00510231   1/2  ----------------------------------------------------------------------
00489213   3/4  ----------------------------------------------------------------------
00469122   2/3  ----------------------------------------------------------------------
00470751   1/3  ----------------------------------------------------------------------
00458741   1/3  ----------------------------------------------------------------------
00473352   2/3  ----------------------------------------------------------------------
00469121   1/3  ----------------------------------------------------------------------
00504162   2/3  ----------------------------------------------------------------------
00383021   1/3  ----------------------------------------------------------------------
00383022   2/3  ----------------------------------------------------------------------
00458742   2/3  ----------------------------------------------------------------------
00458743   3/3  ......................................leellplllellsdp...............dp
00498022   2/2  ...............................................leslselleelle.ellplLlel
00489212   2/4  ----------------------------------------------------------------------
00504161   1/3  ----------------------------------------------------------------------
00504171   1/4  ----------------------------------------------------------------------
00520262   2/2  aalrllgnlls...........................................................
00427712   2/2  lsdllqkskallelalkdedpelrkaalealgllaaalgpeifapy........................
00489211   1/4  ----------------------------------------------------------------------
00504172   2/4  ----------------------------------------------------------------------
00473351   1/3  ----------------------------------------------------------------------
00504174   4/4  qlledssddvrllalslevrklalkalgsllwidlpeifedlleellelllkllesldplleavdddeel
00510712   2/3  ----------------------------------------------------------------------
00510711   1/3  ----------------------------------------------------------------------
00469123   3/3  llellkskdeevrkkalealgelakklpdelllalleellpaLlkllsspdpeevreaalralaklle..
00383023   3/3  --------------------------------------------------eelidellelLlkilellsd
00486662   2/3  ----------------------------------------------------------------------
00486663   3/3  ----------------------------------------------------------------------
00470753   3/3  elaelrkllksdtpldpskrlealkkllyllllgedvsellpellkllsspdpevrrlaylalselaeed
00406423   3/3  ----------------------------------------------------------------------
00510713   3/3  ---------------------------------------------------pellkellkslevdaelle
00439583   3/4  ----------------------------------------------------------------------
00473353   3/3  ...........dpeniellveagllpllvell......................................
00439581   1/4  ----------------------------------------------------------------------
00406422   2/3  ----------------------------------------------------------------------
00504163   3/3  ------------------------------------------------------mednarlknfknkekl
00486661   1/3  ----------------------------------------------------------------------
00439582   2/4  ----------------------------------------------------------------------
00510232   2/2  ......................................................................
00489214   4/4  rplsgkareavsdvleklleeededeededdddddedwsvrraaaellgalasllgpevlpl........
00439584   4/4  ----------------Lkdpdpevrlaaalalgnl..................gdeavplLlellsdedp
00406421   1/3  ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:1960
query           SVVMKTLQSLASIFGRKGFGGIFVKHLGKEIMPVVKRYLSKVDCENEKITESDLVILQECVKVIEVLAMS
00498021   1/2  ----------------------------------------------------------------------
00504173   3/4  ----------------------------------------------------------------------
00427711   1/2  ----------------------------------------------------------------------
00470752   2/3  ----------------------------------------------------------------------
00520261   1/2  ----------------------------------------------------------------------
00510231   1/2  ----------------------------------------------------------------------
00489213   3/4  ----------------------------------------------------------------------
00469122   2/3  ----------------------------------------------------------------------
00470751   1/3  ----------------------------------------------------------------------
00458741   1/3  ----------------------------------------------------------------------
00473352   2/3  ----------------------------------------------------------------------
00469121   1/3  ----------------------------------------------------------------------
00504162   2/3  ----------------------------------------------------------------------
00383021   1/3  ----------------------------------------------------------------------
00383022   2/3  ----------------------------------------------------------------------
00458742   2/3  ----------------------------------------------------------------------
00458743   3/3  evreaalealgklakllgn.......eelaeellplLlkllkdedpevreaalealgdllkklg......
00498022   2/2  lnd....espevreaalkalgrlaeklpelleeylekllplllellsdedpse..............evr
00489212   2/4  ----------------------------------------------------------------------
00504161   1/3  ----------------------------------------------------------------------
00504171   1/4  ----------------------------------------------------------------------
00520262   2/2  ......................................................................
00427712   2/2  ...........................aeellplllellkdpdsdsevreeallalsnlakslg..eefa
00489211   1/4  ----------------------------------------------------------------------
00504172   2/4  ----------------------------------------------------------------------
00473351   1/3  ----------------------------------------------------------------------
00504174   4/4  eplekvrkaaleclgelaslypsl..............................................
00510712   2/3  ----------------------------------------------------------------------
00510711   1/3  ----------------------------------------------------------------------
00469123   3/3  dlpprlalilegilplllkllkdpdpevrraaaraLgnlas.............gdpellealveagllp
00383023   3/3  sdpevryaalraLgklaks..lpelvlpylpllellkdddlsvrlealellsklvneenleeilkeLlel
00486662   2/3  ----------------------------------------------------------------------
00486663   3/3  ----------------------------------------------------------------------
00470753   3/3  pdlllllinlllkllkdpdpevreaAlraLgkladkelleellpillellssldpdpsvRkaAalaLgnl
00406423   3/3  ----------------------------------------------------------------------
00510713   3/3  lllellqsdedeevrlaalraLrnlaedpdnaealiel...gglplLleklL..........kspdpevr
00439583   3/4  ----------------------------------------------------------------------
00473353   3/3  ..........................sdsdpevreaalraLgnlasg.spelleplldl.....gllpll
00439581   1/4  ----------------------------------------------------------------------
00406422   2/3  ----------------------------------------------------------------------
00504163   3/3  dleelrrkreefrveiRkkkreellkkkRnislndeeselledlldlleeleddleelleelpellelln
00486661   1/3  ----------------------------------------------------------------------
00439582   2/4  ----------------------------------------------------------------------
00510232   2/2  ...............lepllglleklldelskssdpevrraaleaLanlssnpenrealvel..egalpa
00489214   4/4  ..............................................llpillqllsssdwrvreaallal
00439584   4/4  lvrraaaraLgnl.............gdeealplllellededplvrraAaeaLgnlgd.pealplLlel
00406421   1/3  ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:2030
query           AKDGKRIQVISLLVQLLVRLLRATSHTEWRKVGPIEKKLHEMAIGRLNAAASMWPAEFKKVIEWNNELKT
00498021   1/2  ----------------------------------------------------------------------
00504173   3/4  ----------------------------------------------------------------------
00427711   1/2  ----------------------------------------------------------------------
00470752   2/3  ----------------------------------------------------------------------
00520261   1/2  ----------------------------------------------------------------------
00510231   1/2  ----------------------------------------------------------------------
00489213   3/4  ----------------------------------------------------------------------
00469122   2/3  ----------------------------------------------------------------------
00470751   1/3  ----------------------------------------------------------------------
00458741   1/3  ----------------------------------------------------------------------
00473352   2/3  ----------------------------------------------------------------------
00469121   1/3  ----------------------------------------------------------------------
00504162   2/3  ----------------------------------------------------------------------
00383021   1/3  ----------------------------------------------------------------------
00383022   2/3  ----------------------------------------------------------------------
00458742   2/3  ----------------------------------------------------------------------
00458743   3/3  ..lpplleellplllelledpdpevrea------------------------------------------
00498022   2/2  eaalsalgellenlspellvpyledlleallkllsdeneevrlaalkalgkllkvlgeslpeseelfkpl
00489212   2/4  ----------------------------------------------------------------------
00504161   1/3  ----------------------------------------------------------------------
00504171   1/4  ----------------------------------------------------------------------
00520262   2/2  .....................-------------------------------------------------
00427712   2/2  pfl.pqliplllkllq.........n--------------------------------------------
00489211   1/4  ----------------------------------------------------------------------
00504172   2/4  ----------------------------------------------------------------------
00473351   1/3  ----------------------------------------------------------------------
00504174   4/4  ......lgpyleqilplllkllqspdldplseevrlaaleflsslleseplkkllltkpi.lpe------
00510712   2/3  ----------------------------------------------------------------------
00510711   1/3  ----------------------------------------------------------------------
00469123   3/3  lLlklLsdpdpevreaaaeaLgnlaed..sp---------------------------------------
00383023   3/3  l..........sdpdpevreea------------------------------------------------
00486662   2/3  ----------------------------------------------------------------------
00486663   3/3  ----------------------------------------------------------------------
00470753   3/3  aeglpdllklvgllplllklLndpd---------------------------------------------
00406423   3/3  ----------------------------------------------------------------------
00510713   3/3  eaAaraLgnlasg.npenrealveagalplL---------------------------------------
00439583   3/4  ----------------------------------------------------------------------
00473353   3/3  lkllsdpdpevreaalkaLgnlaag---------------------------------------------
00439581   1/4  ----------------------------------------------------------------------
00406422   2/3  ----------------------------------------------------------------------
00504163   3/3  sedpevrlqalkaLgkllssek------------------------------------------------
00486661   1/3  ----------------------------------------------------------------------
00439582   2/4  ----------------------------------------------------------------------
00510232   2/2  Llkllkseeeddd....ldpevreaalsaLsnlaydlpeevdenpenleelllegllpalllellk....
00489214   4/4  gslaeglpdqlkpflp.qilpallpllsdpsplvraaalealgklaevlpnelq.........-------
00439584   4/4  lkde.dedvrlaaalaLgnl--------------------------------------------------
00406421   1/3  ----------------------------------------------------------------------


                         -         +         -         -         -         -         *:2100
query           RLESALLLQSTRHAHQISMAKTQEAKTTPVVQQPRIRLTMFGAESN------------------------
00498021   1/2  ----------------------------------------------------------------------
00504173   3/4  ----------------------------------------------------------------------
00427711   1/2  ----------------------------------------------------------------------
00470752   2/3  ----------------------------------------------------------------------
00520261   1/2  ----------------------------------------------------------------------
00510231   1/2  ----------------------------------------------------------------------
00489213   3/4  ----------------------------------------------------------------------
00469122   2/3  ----------------------------------------------------------------------
00470751   1/3  ----------------------------------------------------------------------
00458741   1/3  ----------------------------------------------------------------------
00473352   2/3  ----------------------------------------------------------------------
00469121   1/3  ----------------------------------------------------------------------
00504162   2/3  ----------------------------------------------------------------------
00383021   1/3  ----------------------------------------------------------------------
00383022   2/3  ----------------------------------------------------------------------
00458742   2/3  ----------------------------------------------------------------------
00458743   3/3  ----------------------------------------------------------------------
00498022   2/2  ldel------------------------------------------------------------------
00489212   2/4  ----------------------------------------------------------------------
00504161   1/3  ----------------------------------------------------------------------
00504171   1/4  ----------------------------------------------------------------------
00520262   2/2  ----------------------------------------------------------------------
00427712   2/2  ----------------------------------------------------------------------
00489211   1/4  ----------------------------------------------------------------------
00504172   2/4  ----------------------------------------------------------------------
00473351   1/3  ----------------------------------------------------------------------
00504174   4/4  ----------------------------------------------------------------------
00510712   2/3  ----------------------------------------------------------------------
00510711   1/3  ----------------------------------------------------------------------
00469123   3/3  ----------------------------------------------------------------------
00383023   3/3  ----------------------------------------------------------------------
00486662   2/3  ----------------------------------------------------------------------
00486663   3/3  ----------------------------------------------------------------------
00470753   3/3  ----------------------------------------------------------------------
00406423   3/3  ----------------------------------------------------------------------
00510713   3/3  ----------------------------------------------------------------------
00439583   3/4  ----------------------------------------------------------------------
00473353   3/3  ----------------------------------------------------------------------
00439581   1/4  ----------------------------------------------------------------------
00406422   2/3  ----------------------------------------------------------------------
00504163   3/3  ----------------------------------------------------------------------
00486661   1/3  ----------------------------------------------------------------------
00439582   2/4  ----------------------------------------------------------------------
00510232   2/2  .......ds-------------------------------------------------------------
00489214   4/4  ----------------------------------------------------------------------
00439584   4/4  ----------------------------------------------------------------------
00406421   1/3  ----------------------------------------------------------------------