[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for cele0:AAN63415.1


[Show Plain Result]

## Summary of Sequence Search
   1::400
   1::400  3.3e-62 24.1% 0051981 00519811 1/1   lycosyltransferase/glycogen phosphoryla 
   3::398  1.2e-53 26.1% 0053131 00531311 1/1   lycosyltransferase/glycogen phosphoryla 
   1::401  1.6e-49 24.1% 0043452 00434521 1/1   lycosyltransferase/glycogen phosphoryla 
 186::379  1.5e-33 35.8% 0052623 00526231 1/1   lycosyltransferase/glycogen phosphoryla 
   2::399  1.2e-29 23.1% 0046716 00467161 1/1   lycosyltransferase/glycogen phosphoryla 
 105::402  1.1e-26 25.6% 0038341 00383411 1/1   lycosyltransferase/glycogen phosphoryla 
   1::400


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MVRVTILHPDLGIGGAERLIVDAAVGLQDRGHSVRIFTNQYSRSHCFQETLDLDICTVVPWIPRSIFGKG
00519811   1/1  mkiililevapppkvGGaervvlelaraLakrGhevtvitpgyggllpllellvivvvllllllglvlll
00531311   1/1  --kIllvtpslppvgGvervvlelaralakrghevtvltpgggglle......pgvrvvrlpllrlp...
00434521   1/1  M.killvtselpplikvGGlervvlelakaLaarGhevtvvtpgygglladlllllelivlvggrlllvg
00526231   1/1  ----------------------------------------------------------------------
00467161   1/1  -mKiliv...tgtrpeiiklaplaralkkrpghevtlivtgqhyg.lldqfleelgipidpdlplllggl
00383411   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           HALCAYLKMIIAALYIVIYHKDTDVILSDSVSASQFVLRHFSKAKLVFYCHFPDRLLTKRDGNLKAFYRN
00519811   1/1  lllvllvllllllllllllrplllllldllllllllalllllalllrrekpDivhahdwlpgllalllar
00531311   1/1  ...lllrllllllrlrrllrrlkpDvvhahsplpgllallaarllgiplvvtlhgllpll......lpgl
00434521   1/1  vlrllldgvkvy.rlpapplflrpglpyllpslydyldnalrfalfslaalrrlrrllrrekpDvvhahd
00526231   1/1  ----------------------------------------------------------------------
00467161   1/1  s..lalltgrvliglakvlreekpDvvlvhgdtvstlaaalaakklgipvvhvea.glrtfdrysgapee
00383411   1/1  ----------------------------------allrellpgapigfflHip.........fpssevfr


                         +         -         -         -         -         *         -:210
query           IIDWIEEYTTGLADVICVNSNFTKNVVRETFKSLASQELTVLYPSLNTEFFDSIEASDDFGEEIPRGTKY
00519811   1/1  llgipvvltiHgllplglpsllllgllllllllrllrlllrlalrradaviavSeftaeellklyg.vpp
00531311   1/1  lsrllrlllrlllrradaviavsealaeellelyg.vppekivvipngvdldrfrpapdpelraalrerl
00434521   1/1  whsglaalllklarllgiplvltiHglafqglfpllllsllglpallfglagllrrllrnl.lraalrra
00526231   1/1  ---------------------------------------------vdlerfgp............dpdkp
00467161   1/1  lnrrlidrl.......adlhfapsefarenllk..egipperifvvgnpvidalfklaekalrppllsrs
00383411   1/1  ilpvreellrgllgadligfqtkryarnflsacsrllgseavkkrivrlygrt..vkvtvipigidvdrf


                         -         -         -         +         -         -         -:280
query           VFTSLNRFERKKNIVLALDAFEKLKSNLPADEFSQCHLVIAGGYDLKNPENIEHYDELVEHMKKLELPAD
00519811   1/1  ekivvipnGvdldrfnpapdkllakarlalrrklglppdkpvilfvGRlelprKgldllleAlakllkkl
00531311   1/1  glpedkpvilfvGrlvprKgldlllealalllkrlp.....dvrlvivG........dgplreelealaa
00434521   1/1  drviavSetyaeellrlylglglegllgv.paekivvipngvdtdlfnpapdpelpvnysadtlegklen
00526231   1/1  vilfvgrlvprKgldlllealall.........pdvklvivG........dgplreeleelakllelgle
00467161   1/1  elleklg..ldpdkkvilvtghrrlnedkglelllealaellerlp.....dvrlvivgh.........g
00383411   1/1  aplad.pevkervrelrgllggkklilgvgrldysKGilllleAferllekyp.elrgkvvlvqvg...v


                         -         *         -         -         -         -         +:350
query           QIVFLHSPSDTQKVNLIRRSRAVLYTPDREHFGIVPVEAMYLGTPVIAVNTGGPCESVRNNETGFLVDQT
00519811   1/1  ...lgpdvklvivG........dgplreeleklakelgl.edrvrflGfvsdeelaelyaaadvfvlPSr
00531311   1/1  elgle.drvrflGfvsd..laelyaaadvfvlpSryEgfglvllEAmaaGlPvvatdvgglpevvedget
00434521   1/1  kaalrerlglpdddkplilfvgRlvpqKgidlllealarlle.......pdvrlvivG........dGpl
00526231   1/1  dnviflgfvsdeelaelyaaadvfvlpslyEgfglvllEAmaaGlpviatdvgglpeivedgvtgllvdp
00467161   1/1  ntrgrlelikllg.lpdnvrllgplgyldllallaaadlvvtds.....GgvvlEamalGkPvvvlrdtg
00383411   1/1  psredgeeyeelraeveelvgrIngrfgslgl.tpvvyllgsvsdeellalyraAdvflvtslregmnlv


                         -         -         -         -         *         -         -:420
query           AEAFAEKMIDLMKDEEMYRRMSEEGPKWVQKVFAFEAFARKLDEIIQSTL--------------------
00519811   1/1  yEgfGlvllEAmacGlPviasdvgGlpeivgdg.tGllvdpgdpealaea--------------------
00531311   1/1  Gllveppgdpealaeailrlledpelrarlgeaareraee.fsweava----------------------
00434521   1/1  reelealaeelgl.pdrvrflgfvsdeelaelyaaadvfvlPSryEgfGlv-------------------
00526231   1/1  dvealaeailrlledpelrrelgeaarer-----------------------------------------
00467161   1/1  erpelvdagtgilvgtdpeaiaeaierllsdpelrermseaanp.ygdg---------------------
00383411   1/1  alEamacgtPddkgvlvlsefagaaevlgd...allvnpydvdalaeaikra------------------