[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for cele0:CAA21685.2


[Show Plain Result]

## Summary of Sequence Search
   1::411
  51::255  5.9e-17 23.7% 0046806 00468061 1/1   ab-GAP domain of gyp1p                  
 233::355  8.8e-11 20.8% 0037638 00376381 1/1   ab-GAP domain of gyp1p                  
   1::411


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MHSSFSEPNSPLKEVLVDKWQTASCSDLGEEYVKPGPLARAKFNALRNKREAIDRFLKKHRKEDLSLYID
00468061   1/1  --------------------------------------------------galelklwllfllllglvli
00376381   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           ELRDFAISPGGLVDDEFRAVIWPVLSANLVQNDDLDDVSSSYDSDFESAQSDFDEEPAYEESEELTLEDL
00468061   1/1  dleklrrlvrgGippslRgevWklllgvlplnstewerylllkrkeyeyll..........edslwelle
00376381   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           KGHKEWNQVELDVHRTLSRFPPNISDTHRDVLQTELIPLIVRVLSINPRFNYYQGFHDICLTVLLVCGEV
00468061   1/1  kdselleqIekDvpRtfpelpff....qdgpgqesLrriLlayalynpdvgYvQGmndlaaplllvlldE
00376381   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           DALPVCSNLAKNGSFNNYLLKTLEKSVVRELDLLYVILSRVDPSLEQVMRSVELGTMFGLSWPLTWFSHT
00468061   1/1  edaFwcfvalmerlllldyytpdlp.glqrdllvleellkkvdpe-------------------------
00376381   1/1  ----------------------glpglqrqlevleellkkldpeLykhLeelgidpllfafrWllllFar


                         -         *         -         -         -         -         +:350
query           LKQYQQIVRFFDVFLASSPLLPIYVSAAVVVFRRASILACEREMPFLHRLLTEMPHELPIDTIIKDSVYL
00468061   1/1  ----------------------------------------------------------------------
00376381   1/1  ef.pledvlrlWDvllaeglsllllslslalekssagsallekllpsgllsllglnlplalalslslgsa


                         -         -         -         -         *         -         -:420
query           SKLMPPCLLKTKYTNEYRKIVSKPSKAAVKTIPRYALQFMFVAGTVGAAASFFFFKQIHPM---------
00468061   1/1  ----------------------------------------------------------------------
00376381   1/1  llllp-----------------------------------------------------------------