[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for cele0:CAA86661.1


[Show Plain Result]

## Summary of Sequence Search
   1::799
 404::786  5.8e-14 19.1% 0051023 00510231 1/1   epeat                                   
 130::239  1.9e-13 33.9% 0037738 00377381 1/1   ike                                     
  96::334    2e-13 27.1% 0046244 00462441 1/1   ain-like                                
 131::338  4.5e-13 30.1% 0052014 00520141 1/1   ike                                     
  44::287  1.3e-12 23.5% 0041848 00418481 1/1   ain-like                                
  17::397  9.7e-12 21.3% 0048505 00485051 1/1   ain-like                                
  30::343  2.3e-11 22.8% 0051010 00510101 1/1   ain-like                                
 502::762  5.1e-11 16.9% 0051071 00510711 1/1   epeat                                   
 338::750  2.4e-10 18.2% 0046912 00469121 1/1   epeat                                   
  77::239  2.6e-10 31.1% 0048059 00480591 1/1   ain-like                                
  59::291  5.2e-10 27.9% 0042103 00421031 1/1   ain-like                                
  79::239  5.8e-10 30.3% 0047132 00471321 1/1   ain-like                                
  62::327  1.5e-09 27.7% 0045099 00450991 1/1   ike                                     
  72::406  1.8e-09 22.0% 0047619 00476191 1/1   ain-like                                
 132::239  2.4e-08 35.3% 0046394 00463941 1/1    arm dynein light chain 1               
 544::747  3.1e-08 19.8% 0050416 00504161 1/1   epeat                                   
 133::238  1.4e-07 33.0% 0045746 00457461 1/1   ain-like                                
  32::338  1.8e-07 24.3% 0045711 00457111 1/1   ike                                     
 546::747  3.1e-07 20.6% 0047335 00473351 1/1   epeat                                   
 156::247  3.5e-06 34.4% 0046297 00462971 1/1   ain-like                                
 132::239  4.1e-06 31.4% 0050397 00503971 1/1   ain-like                                
 131::238  0.00044 28.8% 0053105 00531051 1/1   ain-like                                
   1::799


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MDHNAALTTCSTSAIPRLARLATERIAELIENDALPEFDHKVIASCSNDIFEVLRQKKKLNHQTLQTMCS
00510231   1/1  ----------------------------------------------------------------------
00377381   1/1  ----------------------------------------------------------------------
00462441   1/1  ----------------------------------------------------------------------
00520141   1/1  ----------------------------------------------------------------------
00418481   1/1  -------------------------------------------aacscsdllalcsfkgllsvplgllss
00485051   1/1  ----------------rmldlirdlllsispeefanlsnlrrlslsgnsltglpp....lsnlsnlrsld
00510101   1/1  -----------------------------ispsafsnlcslrsldlsnngltslps...sllsnltvLdl
00510711   1/1  ----------------------------------------------------------------------
00469121   1/1  ----------------------------------------------------------------------
00480591   1/1  ----------------------------------------------------------------------
00421031   1/1  ----------------------------------------------------------gslppslsnccs
00471321   1/1  ----------------------------------------------------------------------
00450991   1/1  -------------------------------------------------------------nlpslesld
00476191   1/1  ----------------------------------------------------------------------
00463941   1/1  ----------------------------------------------------------------------
00504161   1/1  ----------------------------------------------------------------------
00457461   1/1  ----------------------------------------------------------------------
00457111   1/1  -------------------------------llklldlnlflcllelqllllllealsslkelnl.sgnd
00473351   1/1  ----------------------------------------------------------------------
00462971   1/1  ----------------------------------------------------------------------
00503971   1/1  ----------------------------------------------------------------------
00531051   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           TSRFQINKIDLMGNKVELQDLELCSNQNLVSFRLGDIDYFPNTNKIQVADVLDTALNRTSRQQLRHLDLS
00510231   1/1  ----------------------------------------------------------------------
00377381   1/1  -----------------------------------------------------------klrlldlsnlv
00462441   1/1  -------------------------ellllllnlsgllplgclcslrvldlsgngltgsiplsllsnlrs
00520141   1/1  ------------------------------------------------------------dsLdLsgnnl
00418481   1/1  lrsldlsgnsitglpcssfsnlsnltvLdLsnnnlsgllslppglgnltnLryLdLsnnnnltglipesl
00485051   1/1  lsgnglsglpslsnlpnLrvLdlsnn.nltg..lps...lgnltnLryLdLsnnnlsglpslsnltnLet
00510101   1/1  sgn.nltglipssfgnltnLryLdLsnn.sltglipsafgnltnLetLdLsnnklgslpsllftnLesLd
00510711   1/1  ----------------------------------------------------------------------
00469121   1/1  ----------------------------------------------------------------------
00480591   1/1  ------ggpsalsnlsnlrtldlsgn.nltgip...lgllsnlrsldlsgnnltgllpsafsnltnLrvL
00421031   1/1  lrgldlsgngltslpalllsnltvLdLsnnnltgllpsslgnltnLrvLdLsnn.nlsglipealgnl..
00471321   1/1  --------gnnnltglippslgnltnLrvLdlsnnnltglipsslgnltnLrtLdlsnnnlsglpp....
00450991   1/1  lsgnrlsdeglellpsalsnltnLreLdLsgn.nlsglglkalpsalsnlpn...LeeLdLsgnnlsglp
00476191   1/1  -snnnltglppl..lpnLryLdLsnn.klsg..lpslgnl.....................pnLetLdls
00463941   1/1  -------------------------------------------------------------lpnLevLdl
00504161   1/1  ----------------------------------------------------------------------
00457461   1/1  --------------------------------------------------------------lslnnisi
00457111   1/1  lsdlglsllasalkllpnlkeLdlsgnklgdeglealaelllkclsnlksLdLsnnnltdeglsalasaL
00473351   1/1  ----------------------------------------------------------------------
00462971   1/1  ----------------------------------------------------------------------
00503971   1/1  -------------------------------------------------------------lggltnltv
00531051   1/1  ------------------------------------------------------------aafqglpnlt


                         +         -         -         -         -         *         -:210
query           GRHRITSNWPTYVARKLPRLESLAFANRSTANETLSQIGASLLNLRFLDISSTCVTDISCISSLRNLEVL
00510231   1/1  ----------------------------------------------------------------------
00377381   1/1  lkllpsllarlpnLrvLdlsgcnsltdllleslas.lpnLksLdLsgnslsglglpsllsnlpnLeeLdL
00462441   1/1  Ldlsgn.nltg.lps..lsnlpnLrvLdLsnnnltg..lps.lgnlpnLryLdLsnnnltglpalgnlpn
00520141   1/1  sglllpsslgnltnLrvLdlsnnslsgsipsslgnllsnlpnlrvLdLsnnklsgllpeslsnllakllp
00418481   1/1  gnltnLetLdLsnnrlsgllpsslgnltnLrvLdLsnn.nltgslpes.lgnlpsLetLdlsnnnltgli
00485051   1/1  LdLsnnsltglpslgnltnLrsLdlsgn.nltg.ips..lsnltsLetLdlnnsltg...lpe.lsnltn
00510101   1/1  lsnn.sltglipsalgnltnLevLdlsnnklsgllilpsalsnlpsLeeLdlsgnsltg..lps..glls
00510711   1/1  ----------------------------------------------------------------------
00469121   1/1  ----------------------------------------------------------------------
00480591   1/1  dlsgn.nltg.ip..alsnlpnLrsLdLsnnnlt..slpgalsnlsnLetLdLsnnkltslpssafsnlt
00421031   1/1  ...................tnLevLdLsnnkllgs.lppsalsnlpsLrvLdLsnnkltglipsslgn.l
00471321   1/1  ..lgnltnLevLdlsnnkltglpplgnlpnLreLdlsnnrltglpp....lsnlpnLevLdlsnnklt..
00450991   1/1  dglfeglellpealgnlpnLeeLdLsnn.rltglgpealasalsslpsLreLdLsnnklsdlgvkllada
00476191   1/1  nn.nlsg.lpsl....lpsLrtLdlsnnnltg..lps.lgnlpsLetLdlsgnkltglpel..lpsLreL
00463941   1/1  snnnltglipeslsnltnLevLdlsnnkltslpplsllpnLeeLdlsnnkltslpp....lsnlpnLevL
00504161   1/1  ----------------------------------------------------------------------
00457461   1/1  lppgafsglpnleeLdLsnnkltslp...glfsglpnLreLdLsnNqltslpp...lsglpnLeeLdLsn
00457111   1/1  aslknLeeLdLsgnklgdeglkaLaealskllknLksLdLs.......gnnltdeglsalasalsnlpnL
00473351   1/1  ----------------------------------------------------------------------
00462971   1/1  ---------------lalllnnnlitlpellsnlpnlrvLdLsnnklts..lpgllsllpnLevLdLsnN
00503971   1/1  LdLsnnnlsg..lipgafgnltnLtvLdlsnnqltglppgalfgnlpnLevLdLsnNnltglipgafgnl
00531051   1/1  tLdLsnnn..ltslppgafsglpnLrvLdLsnNqltsllppgafsglpnLqeLdLsnNklsslppgafag


                         -         -         -         +         -         -         -:280
query           IMYNLNILKGDVTETLSNLTKLRVLDISRKVNTDYLQETSQDAHLDLALGIYNRSVEAIESGTATPWAEL
00510231   1/1  ----------------------------------------------------------------------
00377381   1/1  sgnrltdeipsslgnlpnLkeLdLsgnkl-----------------------------------------
00462441   1/1  LetLdLsnnkltg..lps.lgnlpnLrvLdLsg.......................n.qltslpa..lgn
00520141   1/1  nLrsLdlsgn.klsgeglsilpsalsnlpnLrvLdLsgnnltgeglkslpsslfnglpnLryLdLsgnnl
00418481   1/1  p.eslgnlpnLlrvLdlsnnnlsglipsslgnlnLesLdLsgnkltglipeslgnlpsLreLdLsgnkls
00485051   1/1  LeeLdlsnnnltglpslsnlpnLksLdlsnnnlts..lps.lsnltnLesLdLsnn.nltslp.alsnlp
00510101   1/1  sLteLdlsnnnltglipsalsnlpnLeeLdLsgn.sltglipealgnlpsLkeLdLsn............
00510711   1/1  ----------------------------------------------------------------------
00469121   1/1  ----------------------------------------------------------------------
00480591   1/1  sLeeLdLsgNslt..sipaglfsnltsLe-----------------------------------------
00421031   1/1  psLevLdlsgnkltglipsalsnlpsLrvLdLsnn.nltglipsalsnltsLevLdLsgnrltglipdal
00471321   1/1  .lpsslsnlpnLeeLdLsnNqlsglpplg-----------------------------------------
00450991   1/1  llspllpallgglpnLetLdLsgnrltglglealpsalaslpsLreLdLsgnnltdeglkalppellsgl
00476191   1/1  dlsnnnltg..lps.lgnlpnLksLdlsgnnltg.lps...llpsLeeLdlsgnklsglps....llpnL
00463941   1/1  dLsnNklts..lpgslgnlpnLetLdLsn-----------------------------------------
00504161   1/1  ----------------------------------------------------------------------
00457461   1/1  NrltslppgafsglpnLevLdLsnNkls------------------------------------------
00457111   1/1  teLdLsgnk.lgdeglkaLaellknlpcnLqtLdLsnngltdeglkalasalsslpnLreLdLsgnklgd
00473351   1/1  ----------------------------------------------------------------------
00462971   1/1  rlsslpplsnlpnLevLdLsnNrlsdlpplellanlp---------------------------------
00503971   1/1  pnLeeLdLsn.NqltglipssfgnltnLe-----------------------------------------
00531051   1/1  lpsLtvLdLsn.Nqltslppgafd.lps------------------------------------------


                         -         *         -         -         -         -         +:350
query           RAIDMSGLSIVQFGTDRALAFVEKIIEAHPKLEQISLLATPLDSSLIEIPNRNLQVINTVSRRSIIFALS
00510231   1/1  ----------------------------------------------------------------------
00377381   1/1  ----------------------------------------------------------------------
00462441   1/1  lpsLetLdlsgnpltglpelgnlpslrvldlsgnpltglpllanlpslkvldlp----------------
00520141   1/1  tsiglsalpsslgnlpnLetLdLsgnk.ltgeglkslpeslsnlpvnLreLdLs....------------
00418481   1/1  g..lpss---------------------------------------------------------------
00485051   1/1  nLeeLdlsgnkltglpp..lsnlpsLeeLdlsnnnltslpslsnlpsLkeLdlsnnkltslpslgnlpsL
00510101   1/1  ...........n.nltglpss.lgnlpsLesLdlsnnkltglppeaflgl..lslanlpsLke-------
00510711   1/1  ----------------------------------------------------------------------
00469121   1/1  ---------------------------------------------------------ealgslinklgdp
00480591   1/1  ----------------------------------------------------------------------
00421031   1/1  sglpsLevLdL-----------------------------------------------------------
00471321   1/1  ----------------------------------------------------------------------
00450991   1/1  pnLetLdLsgn.nltdlgllalaealgnlpsLreLdLsgnrlsdlgl-----------------------
00476191   1/1  ksldlsnnplsg............slgnlpsLeeLdlsgnkl.gslp.gllpsLksLdlsnnnltslp.g
00463941   1/1  ----------------------------------------------------------------------
00504161   1/1  ----------------------------------------------------------------------
00457461   1/1  ----------------------------------------------------------------------
00457111   1/1  eglkalaealsnplpnLetLdLsnnnl..tdeglsaLasalaklknLeeLdLsgnnlg------------
00473351   1/1  ----------------------------------------------------------------------
00462971   1/1  ----------------------------------------------------------------------
00503971   1/1  ----------------------------------------------------------------------
00531051   1/1  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           HYANLDRPAFITHALHSVYYQLQSGYDKFSQEELKECLRLVCISMQQGLNTLPVQIAGSACLYHLCKMKR
00510231   1/1  -----------------------------------------------------vrraaleaLanlss.np
00377381   1/1  ----------------------------------------------------------------------
00462441   1/1  ----------------------------------------------------------------------
00520141   1/1  ----------------------------------------------------------------------
00418481   1/1  ----------------------------------------------------------------------
00485051   1/1  etLdlsnnnltslpplsnlpsLksldlsgnpllcpcsllnlpsllvl-----------------------
00510101   1/1  ----------------------------------------------------------------------
00510711   1/1  ----------------------------------------------------------------------
00469121   1/1  ellpellplllellkskdeevrkkalealgelakklpdelllalleellpaLlkllsspdpeevreaalr
00480591   1/1  ----------------------------------------------------------------------
00421031   1/1  ----------------------------------------------------------------------
00471321   1/1  ----------------------------------------------------------------------
00450991   1/1  ----------------------------------------------------------------------
00476191   1/1  llpsLesldlsnnklsslppl....lsslkeldlsgnpllcdcpllgllewlkilh--------------
00463941   1/1  ----------------------------------------------------------------------
00504161   1/1  ----------------------------------------------------------------------
00457461   1/1  ----------------------------------------------------------------------
00457111   1/1  ----------------------------------------------------------------------
00473351   1/1  ----------------------------------------------------------------------
00462971   1/1  ----------------------------------------------------------------------
00503971   1/1  ----------------------------------------------------------------------
00531051   1/1  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           IKRLSVKEVNNCIERSLDAAEQYRSMTQLQKNVWLTICNDYLLHLDEIDFYRTCKVALDTMLLNRDASVE
00510231   1/1  enrealvelegalpaLlkllkseeedddldpevreaalsaLsnlaydlpeevdenpenleelllegllpa
00377381   1/1  ----------------------------------------------------------------------
00462441   1/1  ----------------------------------------------------------------------
00520141   1/1  ----------------------------------------------------------------------
00418481   1/1  ----------------------------------------------------------------------
00485051   1/1  ----------------------------------------------------------------------
00510101   1/1  ----------------------------------------------------------------------
00510711   1/1  ----------------------------------------------------------------------
00469121   1/1  alaklledlpprlalilegilplllkllkd..pdpevrraaaraLgnlasgdpellealve..agllplL
00480591   1/1  ----------------------------------------------------------------------
00421031   1/1  ----------------------------------------------------------------------
00471321   1/1  ----------------------------------------------------------------------
00450991   1/1  ----------------------------------------------------------------------
00476191   1/1  ----------------------------------------------------------------------
00463941   1/1  ----------------------------------------------------------------------
00504161   1/1  ----------------------------------------------------------------------
00457461   1/1  ----------------------------------------------------------------------
00457111   1/1  ----------------------------------------------------------------------
00473351   1/1  ----------------------------------------------------------------------
00462971   1/1  ----------------------------------------------------------------------
00503971   1/1  ----------------------------------------------------------------------
00531051   1/1  ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           RMTIAIVSIVTPKMRPSEAKILTTETKYVYHLVKIMNDYLEAYTREHRVGHERDNENALYTLKFTLSALW
00510231   1/1  lllellkdsdpe..........................................................
00377381   1/1  ----------------------------------------------------------------------
00462441   1/1  ----------------------------------------------------------------------
00520141   1/1  ----------------------------------------------------------------------
00418481   1/1  ----------------------------------------------------------------------
00485051   1/1  ----------------------------------------------------------------------
00510101   1/1  ----------------------------------------------------------------------
00510711   1/1  -----------pellkellkslevdaellelllellqs.................dedeevrlaalraLr
00469121   1/1  lklL..................................................................
00480591   1/1  ----------------------------------------------------------------------
00421031   1/1  ----------------------------------------------------------------------
00471321   1/1  ----------------------------------------------------------------------
00450991   1/1  ----------------------------------------------------------------------
00476191   1/1  ----------------------------------------------------------------------
00463941   1/1  ----------------------------------------------------------------------
00504161   1/1  -----------------------------------------------------mednarlknfknkekld
00457461   1/1  ----------------------------------------------------------------------
00457111   1/1  ----------------------------------------------------------------------
00473351   1/1  -------------------------------------------------------eelllkrrnvllqls
00462971   1/1  ----------------------------------------------------------------------
00503971   1/1  ----------------------------------------------------------------------
00531051   1/1  ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           NLTDECPATCKAFLDAGGVQIAFRILKAFDYHGNVQTKVLGILNNLAEVEELHLGQLCKNEYISVLISCL
00510231   1/1  ....vreaalralgnlasgspelaeellelgvlplllelle.ssedpevreaalgaLgnla.rsepnrlk
00377381   1/1  ----------------------------------------------------------------------
00462441   1/1  ----------------------------------------------------------------------
00520141   1/1  ----------------------------------------------------------------------
00418481   1/1  ----------------------------------------------------------------------
00485051   1/1  ----------------------------------------------------------------------
00510101   1/1  ----------------------------------------------------------------------
00510711   1/1  nla.edpdnaealielgglplLleklLk..spdpevreaAaraLgnlasgnpenrealveagalplLlql
00469121   1/1  ......................................sdpdpevreaaaeaLgnlaedspelrdpllee
00480591   1/1  ----------------------------------------------------------------------
00421031   1/1  ----------------------------------------------------------------------
00471321   1/1  ----------------------------------------------------------------------
00450991   1/1  ----------------------------------------------------------------------
00476191   1/1  ----------------------------------------------------------------------
00463941   1/1  ----------------------------------------------------------------------
00504161   1/1  leelrrkreefrveiRkkkreellkkkRnislndeeselledlldlleeleddleelleelpellellns
00457461   1/1  ----------------------------------------------------------------------
00457111   1/1  ----------------------------------------------------------------------
00473351   1/1  dllseleslldllesleelleellrllqspdpevrlsalkalgellslnndelaeliiesgllpallell
00462971   1/1  ----------------------------------------------------------------------
00503971   1/1  ----------------------------------------------------------------------
00531051   1/1  ----------------------------------------------------------------------


                         -         +         -         -         -         -         *:700
query           DGSFNEVDSKGRYREVERSYFAAGILANLLTNTDGWESENQRDEACEKLLELIEQYPTLPSAMVSYKSFI
00510231   1/1  llealilkeegilplLlell..ssedpe................................vreaaagaLg
00377381   1/1  ----------------------------------------------------------------------
00462441   1/1  ----------------------------------------------------------------------
00520141   1/1  ----------------------------------------------------------------------
00418481   1/1  ----------------------------------------------------------------------
00485051   1/1  ----------------------------------------------------------------------
00510101   1/1  ----------------------------------------------------------------------
00510711   1/1  Ls.................................sspdpevreaalwaLgnlardspearealleaggl
00469121   1/1  gllpaLlkllkdpd.dpevrraaleaLgnlasnpelreel.vlpgllpvLlkllkdp...........dp
00480591   1/1  ----------------------------------------------------------------------
00421031   1/1  ----------------------------------------------------------------------
00471321   1/1  ----------------------------------------------------------------------
00450991   1/1  ----------------------------------------------------------------------
00476191   1/1  ----------------------------------------------------------------------
00463941   1/1  ----------------------------------------------------------------------
00504161   1/1  edpevrlqalkaLgkllssekeelleeliesgllpllvkllkspdpeevrlaalkaLgnlasgspellea
00457461   1/1  ----------------------------------------------------------------------
00457111   1/1  ----------------------------------------------------------------------
00473351   1/1  sndpdpevrlaallaLgnlasgnpenleplleagalpaLlelLs..dpdpevreaalraLgnlakdspel
00462971   1/1  ----------------------------------------------------------------------
00503971   1/1  ----------------------------------------------------------------------
00531051   1/1  ----------------------------------------------------------------------


                         -         -         -         -         +         -         -:770
query           PFSRIVRESNSNGAIMWCLWGVHHVLQHREKNKAPTYEKGYIEMFMDSGLSPIVEDMSHGHSKHIHNLDI
00510231   1/1  nla.sdpenleelle.gllplLlklledededsdenlevrlaalsalanll.........snspelaell
00377381   1/1  ----------------------------------------------------------------------
00462441   1/1  ----------------------------------------------------------------------
00520141   1/1  ----------------------------------------------------------------------
00418481   1/1  ----------------------------------------------------------------------
00485051   1/1  ----------------------------------------------------------------------
00510101   1/1  ----------------------------------------------------------------------
00510711   1/1  paLlellks.pdpkvrrnaawaLsnlasgdpelrealveagalpaLvellsspdpevreaal--------
00469121   1/1  evreaalkaLgnllsvlpeqplieellplLlkllsdpdpevreaalraLg--------------------
00480591   1/1  ----------------------------------------------------------------------
00421031   1/1  ----------------------------------------------------------------------
00471321   1/1  ----------------------------------------------------------------------
00450991   1/1  ----------------------------------------------------------------------
00476191   1/1  ----------------------------------------------------------------------
00463941   1/1  ----------------------------------------------------------------------
00504161   1/1  lleqgilplLlklLs..dpdpevreaalraLgnlasdspelrdplle-----------------------
00457461   1/1  ----------------------------------------------------------------------
00457111   1/1  ----------------------------------------------------------------------
00473351   1/1  rdalleagilppLlellk......nlllsdpdpevreaaasalanla-----------------------
00462971   1/1  ----------------------------------------------------------------------
00503971   1/1  ----------------------------------------------------------------------
00531051   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:840
query           RVVHLAREIIDIVSCHSLSSSPVRLVRRV-----------------------------------------
00510231   1/1  lesgglekLeellk..------------------------------------------------------
00377381   1/1  ----------------------------------------------------------------------
00462441   1/1  ----------------------------------------------------------------------
00520141   1/1  ----------------------------------------------------------------------
00418481   1/1  ----------------------------------------------------------------------
00485051   1/1  ----------------------------------------------------------------------
00510101   1/1  ----------------------------------------------------------------------
00510711   1/1  ----------------------------------------------------------------------
00469121   1/1  ----------------------------------------------------------------------
00480591   1/1  ----------------------------------------------------------------------
00421031   1/1  ----------------------------------------------------------------------
00471321   1/1  ----------------------------------------------------------------------
00450991   1/1  ----------------------------------------------------------------------
00476191   1/1  ----------------------------------------------------------------------
00463941   1/1  ----------------------------------------------------------------------
00504161   1/1  ----------------------------------------------------------------------
00457461   1/1  ----------------------------------------------------------------------
00457111   1/1  ----------------------------------------------------------------------
00473351   1/1  ----------------------------------------------------------------------
00462971   1/1  ----------------------------------------------------------------------
00503971   1/1  ----------------------------------------------------------------------
00531051   1/1  ----------------------------------------------------------------------