[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for cele0:CAB01696.1


[Show Plain Result]

## Summary of Sequence Search
   1::245
   6::191  2.4e-05 21.6% 0053209 00532091 1/1   oid-like                                
   8::190  4.9e-05 20.0% 0053091 00530911 1/1   oid-like                                
   1::245


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MDLENFLLGIPIVTRYWFLASTIIPLLGRFGFINVQWMFLQWDLVVNKFQFWRPLTALIYYPVTPQTGFH
00532091   1/1  -----pllrlppvtlalillnvlvfllllllgldpllllgalppllilkgqlwrlltsmflH....ggll
00530911   1/1  -------nnlppvtlalillnvlvfllllllgldpllslgalppllilkgqlwrlltsmflHg....gll


                         -         -         *         -         -         -         -:140
query           WLMMCYFLYNYSKALESETYRGRSADYLFMLIFNWFFCSGLCMALDIYFLLEPMVISVLYVWCQVNKDTI
00532091   1/1  HllfNmlallvfgrller...llGslrflllyllsgllggllsllfspl.plvGaSGavfgllgalllll
00530911   1/1  HllfNmlallvlgrller...rlGslrflllyllsgllggllsllfsppplvGaSGavfgllgalllllp


                         +         -         -         -         -         *         -:210
query           VSFWFGMRFPARYLPWVLWGFNAVLRGGGTNELVGILVGHAYFFVALKYPDEYGVDLISTPEFLHRLIPD
00532091   1/1  plarll..lllplpallllllllllslllgllgpgvsnaaHlgGllaGlll-------------------
00530911   1/1  larllllf.lpilavvlllllllllllgllgpgvsnlAHlgGllaGlllg--------------------


                         -         -         -         +         -         -         -:280
query           EDGGIHGQDGNIRGARQQPRGHQWPGGVGARLGGN-----------------------------------
00532091   1/1  ----------------------------------------------------------------------
00530911   1/1  ----------------------------------------------------------------------