[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for cele0:CAB60993.2


[Show Plain Result]

## Summary of Sequence Search
   1::388
  11::186  2.1e-44 42.5% 0049769 00497691 1/1   inding domain, RBD                      
  99::201    1e-23 40.8% 0049801 00498012 2/2   inding domain, RBD                      
 101::188    8e-23 46.0% 0047108 00471082 2/2   inding domain, RBD                      
   3::96   2.1e-22 39.4% 0049801 00498011 1/2   inding domain, RBD                      
   4::89   2.2e-22 40.7% 0050839 00508391 1/2   inding domain, RBD                      
  99::183    4e-22 45.7% 0047197 00471972 2/2   inding domain, RBD                      
  11::89   4.9e-22 43.4% 0047108 00471081 1/2   inding domain, RBD                      
  13::90   5.6e-22 44.2% 0049843 00498431 1/2   inding domain, RBD                      
   8::95   1.3e-21 43.9% 0047197 00471971 1/2   inding domain, RBD                      
  91::184  1.5e-21 39.8% 0050839 00508392 2/2   inding domain, RBD                      
  87::184  5.2e-21 38.1% 0049492 00494922 2/2   inding domain, RBD                      
 101::193  5.2e-21 36.7% 0052441 00524412 2/2   inding domain, RBD                      
  99::185  5.6e-21 39.1% 0052218 00522182 2/2   inding domain, RBD                      
  14::89   8.9e-21 45.3% 0047422 00474221 1/2   inding domain, RBD                      
  92::184  8.9e-21 36.6% 0052221 00522212 2/2   inding domain, RBD                      
  91::183  1.2e-20 39.1% 0048682 00486822 2/2   inding domain, RBD                      
  92::183  1.2e-20 38.2% 0036165 00361652 2/2   inding domain, RBD                      
  99::184  1.4e-20 41.2% 0046287 00462872 2/2   inding domain, RBD                      
 100::177  1.6e-20 43.4% 0049843 00498432 2/2   inding domain, RBD                      
 102::184  1.6e-20 41.0% 0050838 00508382 2/2   inding domain, RBD                      
 101::188  1.9e-20 43.7% 0041653 00416532 2/2   inding domain, RBD                      
   5::97     2e-20 37.6% 0052218 00522181 1/2   inding domain, RBD                      
   2::100  2.8e-20 36.4% 0041653 00416531 1/2   inding domain, RBD                      
  12::95   2.8e-20 41.7% 0053313 00533131 1/2   inding domain, RBD                      
   7::91     3e-20 41.2% 0037834 00378341 1/2   inding domain, RBD                      
  99::184  3.6e-20 40.2% 0050802 00508022 2/2   inding domain, RBD                      
  92::191  4.1e-20 36.4% 0050566 00505662 2/2   inding domain, RBD                      
  99::184  4.3e-20 40.0% 0053313 00533132 2/2   inding domain, RBD                      
  12::96   4.5e-20 41.2% 0046287 00462871 1/2   inding domain, RBD                      
  11::96   4.6e-20 40.0% 0052236 00522361 1/2   inding domain, RBD                      
  15::86   4.6e-20 43.1% 0050806 00508061 1/2   inding domain, RBD                      
 101::177  4.6e-20 45.3% 0047422 00474222 2/2   inding domain, RBD                      
  99::210  4.8e-20 29.6% 0052622 00526222 2/2   inding domain, RBD                      
  90::194  5.3e-20 35.9% 0052240 00522402 2/2   inding domain, RBD                      
   9::97   5.4e-20 39.3% 0046286 00462861 1/2   inding domain, RBD                      
  92::182  5.4e-20 40.0% 0050809 00508092 2/2   inding domain, RBD                      
  99::184  5.6e-20 43.8% 0052235 00522352 2/2   inding domain, RBD                      
   4::86   7.7e-20 41.0% 0052239 00522391 1/2   inding domain, RBD                      
  11::92   8.2e-20 41.5% 0045893 00458931 1/2   inding domain, RBD                      
  95::184  8.5e-20 40.4% 0052238 00522382 2/2   inding domain, RBD                      
  92::184  8.7e-20 37.8% 0052243 00522432 2/2   inding domain, RBD                      
   5::89   8.9e-20 41.2% 0052232 00522321 1/2   inding domain, RBD                      
  92::309  9.4e-20 37.5% 0046785 00467852 2/2   inding domain, RBD                      
  96::196  1.1e-19 37.8% 0050466 00504662 2/2   inding domain, RBD                      
  99::184  1.1e-19 42.9% 0052236 00522362 2/2   inding domain, RBD                      
  14::89   1.3e-19 44.0% 0047172 00471721 1/2   inding domain, RBD                      
 102::184  1.3e-19 44.6% 0052219 00522192 2/2   inding domain, RBD                      
   4::89   1.4e-19 40.7% 0048682 00486821 1/2   inding domain, RBD                      
  14::95   1.5e-19 43.0% 0052441 00524411 1/2   inding domain, RBD                      
  99::184  1.5e-19 42.4% 0052231 00522312 2/2   inding domain, RBD                      
   9::93   1.6e-19 40.5% 0052899 00528991 1/2   inding domain, RBD                      
   5::90   1.7e-19 40.7% 0052221 00522211 1/2   inding domain, RBD                      
  10::96   1.9e-19 42.7% 0052235 00522351 1/2   inding domain, RBD                      
   7::97     2e-19 40.5% 0050514 00505141 1/2   inding domain, RBD                      
   3::89   2.1e-19 40.7% 0052240 00522401 1/2   inding domain, RBD                      
   2::94   2.2e-19 41.1% 0052229 00522291 1/2   inding domain, RBD                      
   5::89   2.2e-19 42.2% 0052245 00522451 1/2   inding domain, RBD                      
  11::92   2.3e-19 41.5% 0046876 00468761 1/2   inding domain, RBD                      
   8::96   2.4e-19 39.3% 0052231 00522311 1/2   inding domain, RBD                      
   5::90   2.6e-19 41.0% 0046785 00467851 1/2   inding domain, RBD                      
   8::94   2.6e-19 40.2% 0052238 00522381 1/2   inding domain, RBD                      
  92::196  2.6e-19 34.6% 0048680 00486802 2/2   inding domain, RBD                      
  92::182  2.6e-19 40.0% 0052232 00522322 2/2   inding domain, RBD                      
   8::90   2.7e-19 43.9% 0047631 00476311 1/2   inding domain, RBD                      
  89::210  2.9e-19 36.6% 0042061 00420612 2/2   inding domain, RBD                      
   5::87   3.2e-19 41.0% 0052222 00522221 1/2   inding domain, RBD                      
  96::181  3.2e-19 40.0% 0052899 00528992 2/2   inding domain, RBD                      
  92::184  3.3e-19 37.8% 0052245 00522452 2/2   inding domain, RBD                      
 102::174    4e-19 48.6% 0050806 00508062 2/2   inding domain, RBD                      
  92::184  4.1e-19 36.0% 0052217 00522172 2/2   inding domain, RBD                      
 101::190  4.3e-19 40.2% 0050577 00505772 2/2   inding domain, RBD                      
  14::89   4.4e-19 44.0% 0045373 00453731 1/2   inding domain, RBD                      
   5::90   4.5e-19 40.7% 0048680 00486801 1/2   inding domain, RBD                      
  11::96   4.9e-19 42.0% 0048984 00489841 1/2   inding domain, RBD                      
  95::185    5e-19 40.0% 0050837 00508372 2/2   inding domain, RBD                      
  10::96   5.3e-19 39.3% 0050802 00508021 1/2   inding domain, RBD                      
  99::184  5.4e-19 42.4% 0052229 00522292 2/2   inding domain, RBD                      
  12::92   5.9e-19 43.2% 0052897 00528971 1/2   inding domain, RBD                      
  11::93     7e-19 40.0% 0052622 00526221 1/2   inding domain, RBD                      
  15::96   7.2e-19 37.8% 0052219 00522191 1/2   inding domain, RBD                      
  92::184  7.2e-19 41.0% 0050805 00508052 2/2   inding domain, RBD                      
  99::190  7.3e-19 37.3% 0050480 00504802 2/2   inding domain, RBD                      
 101::177  7.3e-19 45.3% 0047172 00471722 2/2   inding domain, RBD                      
  98::180  7.7e-19 42.7% 0045893 00458932 2/2   inding domain, RBD                      
  99::180  7.9e-19 43.2% 0052897 00528972 2/2   inding domain, RBD                      
   8::94   8.4e-19 40.2% 0050837 00508371 1/2   inding domain, RBD                      
   5::91   9.3e-19 41.2% 0052243 00522431 1/2   inding domain, RBD                      
  11::93   1.1e-18 41.8% 0052442 00524421 1/2   inding domain, RBD                      
  95::200  1.1e-18 33.3% 0050477 00504772 2/2   inding domain, RBD                      
  99::184  1.1e-18 41.8% 0052244 00522442 2/2   inding domain, RBD                      
 101::185  1.1e-18 39.3% 0049775 00497752 2/2   inding domain, RBD                      
   5::90   1.2e-18 39.5% 0050566 00505661 1/2   inding domain, RBD                      
 100::180  1.3e-18 45.0% 0046220 00462202 2/2   inding domain, RBD                      
  14::97   1.4e-18 42.2% 0049775 00497751 1/2   inding domain, RBD                      
  93::189  1.6e-18 34.8% 0049416 00494162 2/2   inding domain, RBD                      
  92::187  1.7e-18 37.2% 0052230 00522302 2/2   inding domain, RBD                      
  98::180  1.8e-18 41.5% 0046876 00468762 2/2   inding domain, RBD                      
   8::97   1.9e-18 42.5% 0050479 00504791 1/2   inding domain, RBD                      
   8::95   1.9e-18 40.2% 0050834 00508341 1/2   inding domain, RBD                      
  96::189  1.9e-18 37.8% 0045747 00457472 2/2   inding domain, RBD                      
  99::177  1.9e-18 45.5% 0047631 00476312 2/2   inding domain, RBD                      
  13::92   2.1e-18 42.5% 0046220 00462201 1/2   inding domain, RBD                      
   1::95   2.3e-18 39.8% 0050466 00504661 1/2   inding domain, RBD                      
  94::179  2.3e-18 42.4% 0037834 00378342 2/2   inding domain, RBD                      
 101::177  2.3e-18 44.0% 0045373 00453732 2/2   inding domain, RBD                      
  98::212  2.5e-18 33.3% 0048984 00489842 2/2   inding domain, RBD                      
  90::181  2.6e-18 37.9% 0042860 00428602 2/2   inding domain, RBD                      
  92::175  2.6e-18 39.8% 0052222 00522222 2/2   inding domain, RBD                      
  99::184  2.7e-18 40.5% 0050803 00508032 2/2   inding domain, RBD                      
  90::193  2.8e-18 36.5% 0051748 00517482 2/2   inding domain, RBD                      
  99::185  2.9e-18 39.5% 0046286 00462862 2/2   inding domain, RBD                      
  99::186  2.9e-18 40.0% 0046794 00467942 2/2   inding domain, RBD                      
  99::183  2.9e-18 44.6% 0050834 00508342 2/2   inding domain, RBD                      
   2::87     3e-18 41.2% 0042061 00420611 1/2   inding domain, RBD                      
  87::177  3.7e-18 38.8% 0045479 00454792 2/2   inding domain, RBD                      
   8::94     4e-18 41.9% 0050803 00508031 1/2   inding domain, RBD                      
  99::190    4e-18 41.6% 0050515 00505152 2/2   inding domain, RBD                      
  92::184  4.4e-18 36.0% 0052223 00522232 2/2   inding domain, RBD                      
  13::91   5.7e-18 43.6% 0048400 00484001 1/2   inding domain, RBD                      
   3::89   7.2e-18 39.8% 0042860 00428601 1/2   inding domain, RBD                      
   7::98   7.2e-18 38.9% 0046794 00467941 1/2   inding domain, RBD                      
  13::90   7.2e-18 42.7% 0052898 00528981 1/2   inding domain, RBD                      
   2::96   7.4e-18 39.8% 0050515 00505151 1/2   inding domain, RBD                      
  91::174  7.6e-18 42.2% 0052239 00522392 2/2   inding domain, RBD                      
  94::177  7.7e-18 38.0% 0052442 00524422 2/2   inding domain, RBD                      
   2::95   8.1e-18 40.2% 0050577 00505771 1/2   inding domain, RBD                      
   6::91   8.5e-18 37.8% 0049416 00494161 1/2   inding domain, RBD                      
   5::89   8.8e-18 41.2% 0050809 00508091 1/2   inding domain, RBD                      
   5::90     9e-18 41.7% 0036165 00361651 1/2   inding domain, RBD                      
  15::94   9.7e-18 42.5% 0050838 00508381 1/2   inding domain, RBD                      
   2::88   1.1e-17 40.0% 0049334 00493341 1/2   inding domain, RBD                      
  99::188  1.1e-17 43.0% 0050514 00505142 2/2   inding domain, RBD                      
   1::98   1.5e-17 39.1% 0050568 00505681 1/2   inding domain, RBD                      
   4::89   1.5e-17 41.2% 0050567 00505671 1/2   inding domain, RBD                      
  91::177  1.5e-17 40.7% 0052248 00522482 2/2   inding domain, RBD                      
 101::187  1.6e-17 37.5% 0052234 00522342 2/2   inding domain, RBD                      
  89::189  1.8e-17 34.7% 0049334 00493342 2/2   inding domain, RBD                      
 100::179  1.8e-17 41.0% 0048400 00484002 2/2   inding domain, RBD                      
   4::89   1.9e-17 40.7% 0052248 00522481 1/2   inding domain, RBD                      
  90::188  1.9e-17 38.5% 0050567 00505672 2/2   inding domain, RBD                      
   8::86   2.1e-17 43.0% 0049492 00494921 1/2   inding domain, RBD                      
 102::184  2.3e-17 45.3% 0050576 00505762 2/2   inding domain, RBD                      
   8::94   2.8e-17 41.8% 0052082 00520821 1/2   inding domain, RBD                      
  90::190  3.2e-17 37.0% 0050481 00504812 2/2   inding domain, RBD                      
 100::178  3.3e-17 44.0% 0052898 00528982 2/2   inding domain, RBD                      
  99::186  3.5e-17 37.0% 0050568 00505682 2/2   inding domain, RBD                      
  99::185  4.5e-17 40.7% 0046795 00467952 2/2   inding domain, RBD                      
  99::190  4.9e-17 36.9% 0050479 00504792 2/2   inding domain, RBD                      
   9::95     5e-17 40.5% 0045747 00457471 1/2   inding domain, RBD                      
   1::94   8.5e-17 42.4% 0050808 00508081 1/2   inding domain, RBD                      
   5::90   9.7e-17 40.5% 0050804 00508041 1/2   inding domain, RBD                      
   5::89   1.3e-16 41.8% 0052217 00522171 1/2   inding domain, RBD                      
   5::90   1.4e-16 42.5% 0052233 00522331 1/2   inding domain, RBD                      
  99::190  1.4e-16 36.4% 0050478 00504782 2/2   inding domain, RBD                      
 101::184  1.8e-16 41.6% 0050808 00508082 2/2   inding domain, RBD                      
  92::194  1.9e-16 33.7% 0050804 00508042 2/2   inding domain, RBD                      
   9::97   2.4e-16 42.3% 0050480 00504801 1/2   inding domain, RBD                      
  12::96   2.4e-16 40.5% 0052244 00522441 1/2   inding domain, RBD                      
   5::89   3.2e-16 43.0% 0052223 00522231 1/2   inding domain, RBD                      
  98::193  3.3e-16 39.3% 0050565 00505652 2/2   inding domain, RBD                      
   7::89     4e-16 42.9% 0051748 00517481 1/2   inding domain, RBD                      
   2::93   5.5e-16 43.8% 0050478 00504781 1/2   inding domain, RBD                      
   8::97   5.6e-16 41.2% 0046795 00467951 1/2   inding domain, RBD                      
  11::92     6e-16 42.1% 0052234 00522341 1/2   inding domain, RBD                      
 101::180  7.4e-16 42.9% 0049888 00498882 2/2   inding domain, RBD                      
   2::92   8.7e-16 37.8% 0049888 00498881 1/2   inding domain, RBD                      
   1::99   1.5e-15 39.8% 0050476 00504761 1/2   inding domain, RBD                      
  95::182  1.5e-15 35.4% 0052082 00520822 2/2   inding domain, RBD                      
  92::184  1.6e-15 37.3% 0052233 00522332 2/2   inding domain, RBD                      
   2::86   1.9e-15 43.8% 0045479 00454791 1/2   inding domain, RBD                      
  14::96   2.2e-15 44.2% 0050807 00508071 1/2   inding domain, RBD                      
  15::96   2.5e-15 42.7% 0050576 00505761 1/2   inding domain, RBD                      
 104::180  2.5e-15 47.9% 0052429 00524292 2/2   inding domain, RBD                      
   8::93     3e-15 38.8% 0050477 00504771 1/2   inding domain, RBD                      
   1::89   3.1e-15 43.2% 0050481 00504811 1/2   inding domain, RBD                      
   5::90     4e-15 40.5% 0052230 00522301 1/2   inding domain, RBD                      
   5::91   6.3e-15 39.7% 0050805 00508051 1/2   inding domain, RBD                      
 101::193  8.4e-15 41.0% 0050476 00504762 2/2   inding domain, RBD                      
  99::183  9.5e-15 35.9% 0050807 00508072 2/2   inding domain, RBD                      
   8::97     1e-14 39.0% 0050565 00505651 1/2   inding domain, RBD                      
  95::190    1e-14 36.5% 0050512 00505122 2/2   inding domain, RBD                      
  17::92   1.2e-14 43.8% 0052429 00524291 1/2   inding domain, RBD                      
   8::89   1.3e-13 41.7% 0050512 00505121 1/2   inding domain, RBD                      
   9::93   3.9e-12 35.1% 0050727 00507271 1/2   inding domain, RBD                      
  96::184  8.2e-12 37.5% 0050727 00507272 2/2   inding domain, RBD                      
 101::167  2.1e-05 25.4% 0044542 00445422 2/2   inding domain, RBD                      
  14::75       0.7 22.6% 0044542 00445421 1/2   inding domain, RBD                      
   1::388


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSAGPIVERNQDATIYVGGLDEKVSESILWELMVQAGPVVSVNMPKDRVTANHQGFGFVEFMGEEDADYA
00497691   1/1  ----------lapepsrtlfVgnLppdvteedLrelFskfGevvsvrivrdketgkskgfafVeFedeed
00498012   2/2  ----------------------------------------------------------------------
00471082   2/2  ----------------------------------------------------------------------
00498011   1/2  --ldallalnglllagrlllvgpsllgkalslplaslpsedppsrtlfVgnLppdvteedLrelFskfGe
00508391   1/2  ---llgledepsrtlfvgnLppdvteedLrelfskfgevvsvrlvrdketgkskgfafVeFeseedaeka
00471972   2/2  ----------------------------------------------------------------------
00471081   1/2  ----------lllllleelellllvllllllllpallppeadppsrtlfVgnLppdvteedLrelFskfG
00498431   1/2  ------------rtlfvgnLpfdvteedLrelfskfgevvsvrlvrdkltgrsrgfafVefeseedaeka
00471971   1/2  -------leerddddtgrsrgygfvefssesggesasralsglnglslggrslkvgpsppspspeeppps
00508392   2/2  ----------------------------------------------------------------------
00494922   2/2  ----------------------------------------------------------------------
00524412   2/2  ----------------------------------------------------------------------
00522182   2/2  ----------------------------------------------------------------------
00474221   1/2  -------------tlfvgnLpldvteedLrelfskfgevvsvrllrdketgrskgfafVefeseedaeka
00522212   2/2  ----------------------------------------------------------------------
00486822   2/2  ----------------------------------------------------------------------
00361652   2/2  ----------------------------------------------------------------------
00462872   2/2  ----------------------------------------------------------------------
00498432   2/2  ----------------------------------------------------------------------
00508382   2/2  ----------------------------------------------------------------------
00416532   2/2  ----------------------------------------------------------------------
00522181   1/2  ----gleedpdsttlfvgnLpfdvteedLrelFskfgevvsvkillllllllildketgkskgfafVeFe
00416531   1/2  -ssllsleprssrtlfvgnlpydvteedLrelfskfGevksvriprdkdgltgkskgfafVeFespedae
00533131   1/2  -----------srtlfvgnLpldvteedLrelfskfgevvsvrlvrdketgkskgfafVefedeedaeka
00378341   1/2  ------eedrssrtlfvgnLppdvteedLrelfskfgevvsvrivrdketgrsrgfafVeFeseedaeka
00508022   2/2  ----------------------------------------------------------------------
00505662   2/2  ----------------------------------------------------------------------
00533132   2/2  ----------------------------------------------------------------------
00462871   1/2  -----------srtlfvgnLppdvteedLrelfskfgevvsvrllrdketgrsrgfafVeFeseedaeka
00522361   1/2  ----------rsglglllsllseesppsrtlfvgnLppdvteedLrelfskfGevvsvrivrdketgksk
00508061   1/2  --------------lfvgnLppdvteedLrelfskfgevvsvrlvrdkltgkskgfafVefeseedaeka
00474222   2/2  ----------------------------------------------------------------------
00526222   2/2  ----------------------------------------------------------------------
00522402   2/2  ----------------------------------------------------------------------
00462861   1/2  --------dppsrtlfvgnLppdvteedLrelfskfgevvsvrlvrdketgrsrgfafVeFedeedaeka
00508092   2/2  ----------------------------------------------------------------------
00522352   2/2  ----------------------------------------------------------------------
00522391   1/2  ---dssleslpsrtlfvgnLppdvteedLrelfskfgevvsvrilrdkntgrsrgfafVeFeseedaeka
00458931   1/2  ----------psrtlfvgnLppdvteedLrelfskfgevvsvrllrdketgrsrgfafVeFeseedaeka
00522382   2/2  ----------------------------------------------------------------------
00522432   2/2  ----------------------------------------------------------------------
00522321   1/2  ----gpledppsrtlfvgnLppdvteedLrelfskfgevvsvrlvrdkntgrskgfafVeFeseedaeka
00467852   2/2  ----------------------------------------------------------------------
00504662   2/2  ----------------------------------------------------------------------
00522362   2/2  ----------------------------------------------------------------------
00471721   1/2  -------------tlfvgnLpldvteedLrelfskfgevvsvrlvrdkltgkskgfafVeFeseedaeka
00522192   2/2  ----------------------------------------------------------------------
00486821   1/2  ---llgledppsrtlfvgnLppdvteedLrelfskfGevvsvrlvrdkntgrskgfafVeFeseedaekA
00524411   1/2  -------------lrrlfVgnLpfdvteeeLrelFskfgevvsvrlvllkdketgksrgfaFVeFeseed
00522312   2/2  ----------------------------------------------------------------------
00528991   1/2  --------dresrtlfvgnLppdvlteedLrelfskfgeivsvrilrdklstgrskgfafVeFeseedae
00522211   1/2  ----spsesrssrtlfvgnLppdvteedLrelFskfGevvsvrlvrdknetgrsrgfafVeFeseedaek
00522351   1/2  ---------llllpeldppsrtlfvgnLppdvteedLrelFskfGevvsvrivrd..tgkskgfafVeFe
00505141   1/2  ------sgsllsllslelrpsrtlfvgnLppdvteedLrelfskfGevvsvrivrd.......gfafVeF
00522401   1/2  --ldssledlpsrtlfVgnLppdvteedLrelFskfGevvsvrivrdketgrskgfafVeFedeedaekA
00522291   1/2  -sssspsesppsrtlfvgnLppdvteedLrelfskfGevvsvrivrdketgrsrgfafVeFeseedaekA
00522451   1/2  ----lgledppsrtlfvgnLppdvteedLrelfskfgevvsvrlvrd..tgkskgfafVeFedeedaekA
00468761   1/2  ----------psrtlfvgnLppdvteedLrelfskfgevvsvrllrdkltgrsrgfafVeFedeedaeka
00522311   1/2  -------eeppsrtlfvgnLppdvteedLrelFskfGevvsvrivrdkntgrsrgfafVeFedpedaekA
00467851   1/2  ----lpeedppsrtlfVgnLppdvteedllelLrelFskfGevvsvrilrd...gkskgfafVeFedeed
00522381   1/2  -------llepsrtlfvgnLppdvteedLrelfskfgevvsvrlvrdketgksrgfafVeFeseedaeka
00486802   2/2  ----------------------------------------------------------------------
00522322   2/2  ----------------------------------------------------------------------
00476311   1/2  -------rsrdsttlfvgnLpfdvteedLkelfskfGevvsvkvvrdk.tgkskgfafVeFeseedaekA
00420612   2/2  ----------------------------------------------------------------------
00522221   1/2  ----lsvesldsttlfVgnLpldvteedLlelrelfskfGevvsvrivrdkntsgsgrsrgfafVtfese
00528992   2/2  ----------------------------------------------------------------------
00522452   2/2  ----------------------------------------------------------------------
00508062   2/2  ----------------------------------------------------------------------
00522172   2/2  ----------------------------------------------------------------------
00505772   2/2  ----------------------------------------------------------------------
00453731   1/2  -------------tlfvgnLpldvteedLrelfskfgevvsvrlvrdkltgrsrgfafVeFeseedaeka
00486801   1/2  ----lpeedppsrtlfvgnLppdvteedLrelfskfGevvsvrivrdkntgrskgfafVeFedeedaekA
00489841   1/2  ----------lpsrtlfvgnLppdlvteedLrelFskfGevvsvrilrdk.....kgfafVeFedeedae
00508372   2/2  ----------------------------------------------------------------------
00508021   1/2  ---------lllagllslelpdsrtlfVgnLppdvteedLrelFskfGevvsvrivrd...gkskgfafV
00522292   2/2  ----------------------------------------------------------------------
00528971   1/2  -----------sttlfvgnLppsvteedLrelfskfgevlsvrlvrdrltgrsrgfafVeFeseedaeka
00526221   1/2  ----------llelppsrtlfvgnLpydvteedLrelFskfGevksvrivrd...grsrgfafVeFedpe
00522191   1/2  --------------lfvgnLppdvteedLrelfskfgevvsvrivrklldketgkskgfafVeFespeda
00508052   2/2  ----------------------------------------------------------------------
00504802   2/2  ----------------------------------------------------------------------
00471722   2/2  ----------------------------------------------------------------------
00458932   2/2  ----------------------------------------------------------------------
00528972   2/2  ----------------------------------------------------------------------
00508371   1/2  -------ldppsrtlfvgnLppdvteedLrelfskfgevvsvrilrdkntgksrgfafVeFeseedaeka
00522431   1/2  ----lleesrdsrtlfvgnLpfdvteedLrelFskfgevvsvrlvrdkntgrskgfafVeFeseedaeka
00524421   1/2  ----------gaaelllptrvllldnmvltrlyvgnlpydvteedlrelfskfGevksvkvprd....ks
00504772   2/2  ----------------------------------------------------------------------
00522442   2/2  ----------------------------------------------------------------------
00497752   2/2  ----------------------------------------------------------------------
00505661   1/2  ----slsesppsrtlfvgnLppdvteedLrelfskfGevvsvrivrdkntgrsrgfafVeFespedaekA
00462202   2/2  ----------------------------------------------------------------------
00497751   1/2  -------------lrtlyVgnLpfdvteedLrelFskfgevvsvrilllllvldketgrskgfafVeFes
00494162   2/2  ----------------------------------------------------------------------
00522302   2/2  ----------------------------------------------------------------------
00468762   2/2  ----------------------------------------------------------------------
00504791   1/2  -------ldrssrtlfvgnLppdvteedLrelFskfGevvsvrivrd.....skgfafVeFedeedaekA
00508341   1/2  -------edppsrtlfvgnLppdvteedLrelFskfGevvsvrivrdk.tgrskgfafVeFespedaekA
00457472   2/2  ----------------------------------------------------------------------
00476312   2/2  ----------------------------------------------------------------------
00462201   1/2  ------------rtlfvgnLppdvteedLrelfskfgevvsvrivrdkltgrskgfafVeFedeedaeka
00504661   1/2  eglsslsslslpselrpsrtlfvgnLppdvteedLrelFskfGevvsgvrivrdk.tgkskGfafVeFes
00378342   2/2  ----------------------------------------------------------------------
00453732   2/2  ----------------------------------------------------------------------
00489842   2/2  ----------------------------------------------------------------------
00428602   2/2  ----------------------------------------------------------------------
00522222   2/2  ----------------------------------------------------------------------
00508032   2/2  ----------------------------------------------------------------------
00517482   2/2  ----------------------------------------------------------------------
00462862   2/2  ----------------------------------------------------------------------
00467942   2/2  ----------------------------------------------------------------------
00508342   2/2  ----------------------------------------------------------------------
00420611   1/2  -knesgaellpsttlfvgnlppdvteedLkelFskfGevksvkiird......kgfafVeFedeaedaek
00454792   2/2  ----------------------------------------------------------------------
00508031   1/2  -------eerpsrtlfvgnLpfdvteedLrelFskfGevvsvrivrdkntgrskgfafVeFeseedaekA
00505152   2/2  ----------------------------------------------------------------------
00522232   2/2  ----------------------------------------------------------------------
00484001   1/2  ------------rtlfvgnLpfdvteedLrelfskfgevvsvkilrdk.tgrsrgfafVefeseedaekA
00428601   1/2  --gssssseppsrtlfvgnLppdvteedLrelfskfgevvsvrllrdk....skgfafVeFeseedaekA
00467941   1/2  ------eesrpsrtlfVgnLppdvteedLrelFskfgevvsvriv.dketgrsrgfafVeFeseedaekA
00528981   1/2  ------------ttlfvgnLplsvteedLrelFskfgevlsvrilrd..tgkskgfafVeFeseedaekA
00505151   1/2  -sslsslslplelrpsrtlfvgnLppdvteedLrelFskfGevevsvrivrdk.tgkskgfafVeFesee
00522392   2/2  ----------------------------------------------------------------------
00524422   2/2  ----------------------------------------------------------------------
00505771   1/2  -ssslssesrpsrtlfvgnLpydvteedLrelFskfg.vvsvrivrdkletgrskgfafVeFeseedaek
00494161   1/2  -----ledpppsrtlfVgnLpydvteedLrelFskfGevlsvrilrdk....skgfafVeFedpedAekA
00508091   1/2  ----lseedlesrtlfvgnLpfdvteedLrelfskfGevvsvrivrdketgrskgfafVeFeseedaeka
00361651   1/2  ----sseedlpsrtlfvgnLppdvteedLrelfskfGevvsvrilrd..tgkskgfafVeFeseedaeka
00508381   1/2  --------------lfvgnLppdvteedLrelfskfgevvsvrllrddketgkskgfafVeFedeedaek
00493341   1/2  -lllelsedlssrtlfvgnLpfdvteedLrelFskfGevvsvrlvrdk.tgkskgfafVeFeseedaekA
00505142   2/2  ----------------------------------------------------------------------
00505681   1/2  gsslsssasppsrtlfVgnLppdvteedLrelFskfGevvsvkvvrd......kgfafVeFedeedaekA
00505671   1/2  ---glspseerpsrtlfVgnLppdvteedLrelFskfGevvsvrivrdkn......fafVeFedeedaek
00522482   2/2  ----------------------------------------------------------------------
00522342   2/2  ----------------------------------------------------------------------
00493342   2/2  ----------------------------------------------------------------------
00484002   2/2  ----------------------------------------------------------------------
00522481   1/2  ---llgsessssttlfvgnLpfdvteedLrelfskfgevvsvrllrdketgrskgfafVeFeseedaekA
00505672   2/2  ----------------------------------------------------------------------
00494921   1/2  -------esppsrtlfvgnLppdvteedLrelfskfGevvsvrilrdkntgrsrgfafVeFeseedaekA
00505762   2/2  ----------------------------------------------------------------------
00520821   1/2  -------ldresrtlfvgnlp..vteedLrelfskfgevvsvkilrd......rgfafVefedpedaekA
00504812   2/2  ----------------------------------------------------------------------
00528982   2/2  ----------------------------------------------------------------------
00505682   2/2  ----------------------------------------------------------------------
00467952   2/2  ----------------------------------------------------------------------
00504792   2/2  ----------------------------------------------------------------------
00457471   1/2  --------lppsrtlfvgnLppdvteedlkelLrelfskfGevvsvrvlrd...gksrgfafVeFedeed
00508081   1/2  gssllseepppsrtlfvgnLppdvteedLrelfskfGevvsvrivrd......kgfafVeFeseedaekA
00508041   1/2  ----lgpsrrsgtrlfVgnLppdvteedLkdlfskfGevvsvkvvrd.......gfafVeFeseedaekA
00522171   1/2  ----dssllppsrtlfvgnLppdvteedLrelfskfgevvsvrilrd......kgfafVeFedeedaekA
00522331   1/2  ----llsegppsrtlfvgnLppdvteeeLrelfspfGevvsvrllrd......kgfAfVeFedeedaekA
00504782   2/2  ----------------------------------------------------------------------
00508082   2/2  ----------------------------------------------------------------------
00508042   2/2  ----------------------------------------------------------------------
00504801   1/2  --------dppsrtlfVgnLplpdvteedLrelFskfGevvsvriv........kgfafVeFedeedaek
00522441   1/2  -----------sttlfvgnLppdvteedLrelfskfgevvsvrl......grsrgfafVefedeedaekA
00522231   1/2  ----lgeesppsrtlfvgnLppdvteedLrelfskfGevvsvrllrd......kgfafVeFedeedaekA
00505652   2/2  ----------------------------------------------------------------------
00517481   1/2  ------sslslalppsrtlfVgnLppdvteedLrelfskfGevvsvrilrd......kgfafVeFedeed
00504781   1/2  -ssgsssssresrtlfvgnLpysateedlrelFskfg.vvsvrlvrdk.tgrskgfafVeFaseedaekA
00467951   1/2  -------eerpsrtlfvgnLpfdvteedLrelfskfgevvsvri.....tgkskgfafVeFeseedaekA
00522341   1/2  ----------psrtlfvgnLppdvteedLrelFskfGevesvkllrd......kgyafVeFeseedaekA
00498882   2/2  ----------------------------------------------------------------------
00498881   1/2  -ssvsgslgppsrtlfVgnlppdvteesllledlledLrelFskyGevvsvriv........kgyafVeF
00504761   1/2  gssgspsesppsrtlfvgnLppdvteedLrelfskfGevvsvkilrd......kgfAfVeFeseedaekA
00520822   2/2  ----------------------------------------------------------------------
00522332   2/2  ----------------------------------------------------------------------
00454791   1/2  -ssslgsedppsrtlfvgnLppdvteedLrelfskfGevvsvrllrd.....skgfafVeFedeedaekA
00508071   1/2  -------------tlyvgnLpydlvteeeLrelfspfGkvvsvrllrd......kgfAfVefetredAea
00505761   1/2  --------------lfvgnLpfdvteedLrelfskfgevlsv.......tgkskgfafVefeseedaekA
00524292   2/2  ----------------------------------------------------------------------
00504771   1/2  -------lsspsttLfvgnLppevflldeteedleelFskygkivsvril......kskgfafVeFenpe
00504811   1/2  gssslssesrpsrtlfVgnLppedvteedLrelFskfGevvsvrv........skgfafVeFedeedaek
00522301   1/2  ----sssessssttlfvgnLpfsvteedLrelFskfgevlssvrilrdk.tgrskgfafVeFeseedaek
00508051   1/2  ----ssselepsrvlfvgnlpydlvteedLrelfspfGkvlsvkvlrd......kgfAfVefeteedAea
00504762   2/2  ----------------------------------------------------------------------
00508072   2/2  ----------------------------------------------------------------------
00505651   1/2  -------esppsrvlfvgnlpkevteedLrelFskfGnvlsvkv........skgfAfVefespesAqaA
00505122   2/2  ----------------------------------------------------------------------
00524291   1/2  ----------------VgnLpldvteedLkelfskygkvlsvkilrdk...nskgfafVefesledalkA
00505121   1/2  -------lsssstrlfvgnLpfdvteeeLrelfskfgevl.......lltgkskgfafVefeneedaqkA
00507271   1/2  --------dldsttvfvgnlppslt.eellelfskfGeilsvrllrd......kgfafvefeskesAekA
00507272   2/2  ----------------------------------------------------------------------
00445422   2/2  ----------------------------------------------------------------------
00445421   1/2  -------------lsklvirnLPptlteeellellsplgeldyfyyfpgdfstkpskysrayvnfksped


                         -         -         *         -         -         -         -:140
query           IKILNMIKLYGKPIKVNKASAHEKNMDVGANIFVGNLDPEVDEKLLYDTFSAFGVILQVPKIMRDVDSGT
00497691   1/1  aekAle.lngkeldgrrlrvelakpkksrsrgggglpgrtlfvgnlppdvteedlrelfskfGevvsv.r
00498012   2/2  ----------------------------ldallalnglllagrlllvgpsllgkalslplaslpsedpps
00471082   2/2  ------------------------------lllllleelellllvllllllllpallppeadppsrtlfV
00498011   1/2  vvsvrivrdkntgkskGfafVeFese--------------------------------------------
00508391   1/2  lealngteldgrplrvela---------------------------------------------------
00471972   2/2  ----------------------------leerddddtgrsrgygfvefssesggesasralsglnglslg
00471081   1/2  evksvkivrdketgkskgf---------------------------------------------------
00498431   1/2  le.lnglllggrplrvelak--------------------------------------------------
00471971   1/2  rtlfvgnLppdvteedLrelFskfG---------------------------------------------
00508392   2/2  --------------------llgledepsrtlfvgnLppdvteedLrelfskfgevvsv.rlvrdketgk
00494922   2/2  ----------------lgslslgsesppsrtlfvgnLppdvteedLrelfskfGevvsv.rilrdkntgr
00524412   2/2  ------------------------------lrrlfVgnLpfdvteeeLrelFskfgevvsvrlvllkdke
00522182   2/2  ----------------------------gleedpdsttlfvgnLpfdvteedLrelFskfgevvsvkill
00474221   1/2  le.lnglllggrplrvelA---------------------------------------------------
00522212   2/2  ---------------------spsesrssrtlfvgnLppdvteedLrelFskfGevvsvrlvrdknetgr
00486822   2/2  --------------------llgledppsrtlfvgnLppdvteedLrelfskfGevvsv.rlvrdkntgr
00361652   2/2  ---------------------sseedlpsrtlfvgnLppdvteedLrelfskfGevvsvrilrd...tgk
00462872   2/2  ----------------------------srtlfvgnLppdvteedLrelfskfgevvsv.rllrdketgr
00498432   2/2  -----------------------------rtlfvgnLpfdvteedLrelfskfgevvsv.rlvrdkltgr
00508382   2/2  -------------------------------lfvgnLppdvteedLrelfskfgevvsvrllrddketgk
00416532   2/2  ------------------------------tlfvgnlpydvteedLrelfskfGevksv.riprdkdglt
00522181   1/2  spedaekAiealngkelggrklrvela-------------------------------------------
00416531   1/2  kAlealngrkldgrplrvelakpkkerrgr----------------------------------------
00533131   1/2  lealnglelggrplrvelakpkeer---------------------------------------------
00378341   1/2  lealngkllggrplrvelakp-------------------------------------------------
00508022   2/2  ----------------------------lllagllslelpdsrtlfVgnLppdvteedLrelFskfGevv
00505662   2/2  ---------------------slsesppsrtlfvgnLppdvteedLrelfskfGevvs.vrivrdkntgr
00533132   2/2  ----------------------------srtlfvgnLpldvteedLrelfskfgevvsv.rlvrdketgk
00462871   1/2  lealngkllggrplrvelakpkeerd--------------------------------------------
00522361   1/2  gfafVeFeseedaekAle.lngkeld--------------------------------------------
00508061   1/2  lealngllldgrllrV------------------------------------------------------
00474222   2/2  ------------------------------tlfvgnLpldvteedLrelfskfgevvsv.rllrdketgr
00526222   2/2  ----------------------------llelppsrtlfvgnLpydvteedLrelFskfGevksvrivrd
00522402   2/2  -------------------ldssledlpsrtlfVgnLppdvteedLrelFskfGevvsv.rivrdketgr
00462861   1/2  lealngkeldgrplrvelakpkedrrg-------------------------------------------
00508092   2/2  ---------------------lseedlesrtlfvgnLpfdvteedLrelfskfGevvsv.rivrdketgr
00522352   2/2  ----------------------------llllpeldppsrtlfvgnLppdvteedLrelFskfGevvsvr
00522391   1/2  lealngklldgrplrV------------------------------------------------------
00458931   1/2  lealngkllggrplrvelakpk------------------------------------------------
00522382   2/2  ------------------------llepsrtlfvgnLppdvteedLrelfskfgevvsv.rlvrdketgk
00522432   2/2  ---------------------lleesrdsrtlfvgnLpfdvteedLrelFskfgevvsv.rlvrdkntgr
00522321   1/2  lealngklldgrplrvela---------------------------------------------------
00467852   2/2  ---------------------lpeedppsrtlfVgnLppdvteedllelLrelFskfGevvsv.rilrd.
00504662   2/2  -------------------------eglsslsslslpselrpsrtlfvgnLppdvteedLrelFskfGev
00522362   2/2  ----------------------------rsglglllsllseesppsrtlfvgnLppdvteedLrelfskf
00471721   1/2  le.lnglllggrllrvelA---------------------------------------------------
00522192   2/2  -------------------------------lfvgnLppdvteedLrelfskfgevvsvrivrklldket
00486821   1/2  lealngkeldgrplrvela---------------------------------------------------
00524411   1/2  aekAlkalngteldgrplrvewakp---------------------------------------------
00522312   2/2  ----------------------------srtlfvgnLppdvteedLrelFskfGevvsv.rivrdkntgr
00528991   1/2  kAle.lngkllggrplrvelakp-----------------------------------------------
00522211   1/2  aleallngtelggrplrvel--------------------------------------------------
00522351   1/2  seedaekAiealngkeldgrplrvel--------------------------------------------
00505141   1/2  edeedaekAlealngkeldsllgslrp-------------------------------------------
00522401   1/2  lealng.elggrplrvela---------------------------------------------------
00522291   1/2  lealngkelggrplrvelakpkee----------------------------------------------
00522451   1/2  lealngkeldgrplrvela---------------------------------------------------
00468761   1/2  lealngklldgrplrvelakpk------------------------------------------------
00522311   1/2  lealngkelggrplrvelakpkeerg--------------------------------------------
00467851   1/2  aekAlealngkeldgrplrv--------------------------------------------------
00522381   1/2  lealngteldgrplrvelakpkee----------------------------------------------
00486802   2/2  ---------------------lpeedppsrtlfvgnLppdvteedLrelfskfGevvs.vrivrdkntgr
00522322   2/2  ---------------------gpledppsrtlfvgnLppdvteedLrelfskfgevvsv.rlvrdkntgr
00476311   1/2  iealngrelggrplkvelak--------------------------------------------------
00420612   2/2  ------------------knesgaellpsttlfvgnlppdvteedLkelFskfGevksv.kiird.....
00522221   1/2  edaekAiealngtlldg-----------------------------------------------------
00528992   2/2  -------------------------dresrtlfvgnLppdvlteedLrelfskfgeivsvrilrdklstg
00522452   2/2  ---------------------lgledppsrtlfvgnLppdvteedLrelfskfgevvsvrlvrd...tgk
00508062   2/2  -------------------------------lfvgnLppdvteedLrelfskfgevvsv.rlvrdkltgk
00522172   2/2  ---------------------dssllppsrtlfvgnLppdvteedLrelfskfgevvsvrilrd......
00505772   2/2  ------------------------------tlfvgnLpydvteedLrelFskfg.vvs.vrivrdkletg
00453731   1/2  le.lngkllggrllrvelA---------------------------------------------------
00486801   1/2  lealngkelggrplrvelak--------------------------------------------------
00489841   1/2  kAlealngkelggrplrvelakpkel--------------------------------------------
00508372   2/2  ------------------------ldppsrtlfvgnLppdvteedLrelfskfgevvsv.rilrdkntgk
00508021   1/2  eFedpedaekAiealngtelggrplr--------------------------------------------
00522292   2/2  ----------------------------srtlfvgnLppdvteedLrelfskfGevvsv.rivrdketgr
00528971   1/2  iealngkeldgrplrvelakpk------------------------------------------------
00526221   1/2  daekAlealngkelggrplrvel-----------------------------------------------
00522191   1/2  ekAlealngklldgrklrvelakpkd--------------------------------------------
00508052   2/2  ---------------------ssselepsrvlfvgnlpydlvteedLrelfspfGkvls.vkvlrd....
00504802   2/2  ----------------------------srtlfVgnLplpdvteedLrelFskfGevvsvriv.......
00471722   2/2  ------------------------------tlfvgnLpldvteedLrelfskfgevvsv.rlvrdkltgk
00458932   2/2  ---------------------------psrtlfvgnLppdvteedLrelfskfgevvsv.rllrdketgr
00528972   2/2  ----------------------------sttlfvgnLppsvteedLrelfskfgevlsv.rlvrdrltgr
00508371   1/2  lealngkeldgrplrvelakpked----------------------------------------------
00522431   1/2  l..lngkelggrplrvklakp-------------------------------------------------
00524421   1/2  kgfafVeFkdpedAekAiealng-----------------------------------------------
00504772   2/2  ------------------------lsspsttLfvgnLppevflldeteedleelFskygkivsvril...
00522442   2/2  ----------------------------sttlfvgnLppdvteedLrelfskfgevvsvrl.......gr
00497752   2/2  ------------------------------lrtlyVgnLpfdvteedLrelFskfgevvsvrilllllvl
00505661   1/2  lealngkeldgrplrvelak--------------------------------------------------
00462202   2/2  -----------------------------rtlfvgnLppdvteedLrelfskfgevvsv.rivrdkltgr
00497751   1/2  vedaekAle.lngtelggrplrvklak-------------------------------------------
00494162   2/2  ----------------------ledpppsrtlfVgnLpydvteedLrelFskfGevlsvrilrdk.....
00522302   2/2  ---------------------sssessssttlfvgnLpfsvteedLrelFskfgevlssvrilrdk.tgr
00468762   2/2  ---------------------------psrtlfvgnLppdvteedLrelfskfgevvsv.rllrdkltgr
00504791   1/2  l..lngkeldgrplrvelakpkeerss-------------------------------------------
00508341   1/2  lealngkelggrplrvelakpkeer---------------------------------------------
00457472   2/2  -------------------------lppsrtlfvgnLppdvteedlkelLrelfskfGevvsvrvlrd..
00476312   2/2  ----------------------------sttlfvgnLpfdvteedLkelfskfGevvsv.kvvrdk.tgk
00462201   1/2  lealngkllggrplrvelakpk------------------------------------------------
00504661   1/2  eedaekAl.alngkelggrplrvel---------------------------------------------
00378342   2/2  -----------------------eedrssrtlfvgnLppdvteedLrelfskfgevvsv.rivrdketgr
00453732   2/2  ------------------------------tlfvgnLpldvteedLrelfskfgevvsv.rlvrdkltgr
00489842   2/2  ---------------------------lpsrtlfvgnLppdlvteedLrelFskfGevvsv.rilrdk..
00428602   2/2  -------------------gssssseppsrtlfvgnLppdvteedLrelfskfgevvsvrllrdk.....
00522222   2/2  ---------------------lsvesldsttlfVgnLpldvteedLlelrelfskfGevvsv.rivrdkn
00508032   2/2  ----------------------------srtlfvgnLpfdvteedLrelFskfGevvs.vrivrdkntgr
00517482   2/2  -------------------sslslalppsrtlfVgnLppdvteedLrelfskfGevvsv.rilrd.....
00462862   2/2  ----------------------------srtlfvgnLppdvteedLrelfskfgevvsv.rlvrdketgr
00467942   2/2  ----------------------------srtlfVgnLppdvteedLrelFskfgevvsvriv..dketgr
00508342   2/2  ----------------------------srtlfvgnLppdvteedLrelFskfGevvsv.rivrdk.tgr
00420611   1/2  Alealngtkldgrplrv-----------------------------------------------------
00454792   2/2  ----------------pgssslgsedppsrtlfvgnLppdvteedLrelfskfGevvsvrllrd......
00508031   1/2  le.lngtelggrplrvelakpkee----------------------------------------------
00505152   2/2  ----------------------------sslsslslplelrpsrtlfvgnLppdvteedLrelFskfGev
00522232   2/2  ---------------------lgeesppsrtlfvgnLppdvteedLrelfskfGevvsvrllrd......
00484001   1/2  lealngkllggrplrvelakp-------------------------------------------------
00428601   1/2  lealngkelgggrplrvel---------------------------------------------------
00467941   1/2  le.lngtelggrplrvelakpksdrggg------------------------------------------
00528981   1/2  le.lngtllggrllrvelak--------------------------------------------------
00505151   1/2  daekAle.lngkelggrplrvelakp--------------------------------------------
00522392   2/2  --------------------dssleslpsrtlfvgnLppdvteedLrelfskfgevvsv.rilrdkntgr
00524422   2/2  -----------------------gaaelllptrvllldnmvltrlyvgnlpydvteedlrelfskfGevk
00505771   1/2  Ale.lngkelggrplrvelakpkee---------------------------------------------
00494161   1/2  lealngteldgrplrvefaks-------------------------------------------------
00508091   1/2  lealngllllpgtlldgrp---------------------------------------------------
00361651   1/2  lealngkllggrplrvelak--------------------------------------------------
00508381   1/2  alealngkllggrplrvelakpke----------------------------------------------
00493341   1/2  le.lngkelggrplrvkl----------------------------------------------------
00505142   2/2  ----------------------------sgsllsllslelrpsrtlfvgnLppdvteedLrelfskfGev
00505681   1/2  iealngkelggrplrvelakpkedrssg------------------------------------------
00505671   1/2  Alealngkeldgrplrvel---------------------------------------------------
00522482   2/2  --------------------llgsessssttlfvgnLpfdvteedLrelfskfgevvsv.rllrdketgr
00522342   2/2  ------------------------------tlfvgnLppdvteedLrelFskfGevesvkllrd......
00493342   2/2  ------------------lllelsedlssrtlfvgnLpfdvteedLrelFskfGevvsv.rlvrdk.tgk
00484002   2/2  -----------------------------rtlfvgnLpfdvteedLrelfskfgevvsvkilrdk..tgr
00522481   1/2  lealngkllggrplrvelA---------------------------------------------------
00505672   2/2  -------------------glspseerpsrtlfVgnLppdvteedLrelFskfGevvsv.rivrdkn...
00494921   1/2  lealngkelggrplrv------------------------------------------------------
00505762   2/2  -------------------------------lfvgnLpfdvteedLrelfskfgevlsv........tgk
00520821   1/2  iealngkelggrplrvelakpkse----------------------------------------------
00504812   2/2  -------------------sslssesrpsrtlfVgnLppedvteedLrelFskfGevvsvrv........
00528982   2/2  -----------------------------ttlfvgnLplsvteedLrelFskfgevlsvrilrd...tgk
00505682   2/2  ----------------------------srtlfVgnLppdvteedLrelFskfGevvsvkvvrd......
00467952   2/2  ----------------------------srtlfvgnLpfdvteedLrelfskfgevvsvri......tgk
00504792   2/2  ----------------------------srtlfvgnLppdvteedLrelFskfGevvsvrivrd......
00457471   1/2  aekAlealngkeldgrplrvelakp---------------------------------------------
00508081   1/2  lealngkeldgrplrvelakpkee----------------------------------------------
00508041   1/2  ieklngteldgrrlrvelar--------------------------------------------------
00522171   1/2  lealngklldgrplrvela---------------------------------------------------
00522331   1/2  lealngtplllggrplrvef--------------------------------------------------
00504782   2/2  ----------------------------srtlfvgnLpysateedlrelFskfg.vvsvrlvrdk..tgr
00508082   2/2  ------------------------------tlfvgnLppdvteedLrelfskfGevvsvrivrd......
00508042   2/2  ---------------------lgpsrrsgtrlfVgnLppdvteedLkdlfskfGevvsvkvvrd......
00504801   1/2  Aiealngkelggrplrvelakpksers-------------------------------------------
00522441   1/2  lealngkllldgrplrvelakpkser--------------------------------------------
00522231   1/2  lealngteldgrplrvela---------------------------------------------------
00505652   2/2  ---------------------------psrvlfvgnlpkevteedLrelFskfGnvlsvkv.........
00517481   1/2  aekAlealngkelllggrp---------------------------------------------------
00504781   1/2  lk.lngtelggrpirvelaspke-----------------------------------------------
00467951   1/2  lealngkeldgrplrvelakpkeerrg-------------------------------------------
00522341   1/2  iealngkelggrplrvewakpk------------------------------------------------
00498882   2/2  ------------------------------tlfVgnlppdvteesllledlledLrelFskyGevvsvri
00498881   1/2  adeesaekAl.alngrelggrp------------------------------------------------
00504761   1/2  lealngtplllggrplrveyakpkellls-----------------------------------------
00520822   2/2  ------------------------ldresrtlfvgnlp..vteedLrelfskfgevvsvkilrd......
00522332   2/2  ---------------------llsegppsrtlfvgnLppdvteeeLrelfspfGevvsvrllrd......
00454791   1/2  lealngklllggrplk------------------------------------------------------
00508071   1/2  Aiealslngkelggrplrvefakpkk--------------------------------------------
00505761   1/2  lealngtllggrplrvelakpkedrr--------------------------------------------
00524292   2/2  ---------------------------------VgnLpldvteedLkelfskygkvlsv.kilrdkn...
00504771   1/2  dAakAlealngtellgkelkvef-----------------------------------------------
00504811   1/2  Aiealngkeldgrplrvel---------------------------------------------------
00522301   1/2  Ale.lngkelggrplrvela--------------------------------------------------
00508051   1/2  alealnglglllggrplrvsl-------------------------------------------------
00504762   2/2  ------------------------------tlfvgnLppdvteedLrelfskfGevvsvkilrd......
00508072   2/2  ----------------------------srtlyvgnLpydlvteeeLrelfspfGkvvsvrllrd.....
00505651   1/2  iealnglellgrplkvkfakskeerls-------------------------------------------
00505122   2/2  ------------------------lsssstrlfvgnLpfdvteeeLrelfskfgevl........lltgk
00524291   1/2  iealnglllggrplrvslaksk------------------------------------------------
00505121   1/2  iealngtelkgrplvVela---------------------------------------------------
00507271   1/2  l.elngkvlggrlllkvelakdk-----------------------------------------------
00507272   2/2  -------------------------dldsttvfvgnlppslt.eellelfskfGeilsvrllrd......
00445422   2/2  ------------------------------lsklvirnLPptlteeellellsplgeldyfyyfpgdfst
00445421   1/2  avefi-----------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           SKGFAFINFASFEASDTALEAMNGQFLCNRAITVSYAFKRDSKGERHGTAAERMLAAQNPLFPKDRPHQV
00497691   1/1  ivrdketgkskgfgfVeFeseesaekAlealngtllggrplrvsla------------------------
00498012   2/2  rtlfVgnLppdvteedLrelFskfGevvsv.rivrdkntgkskGfafVeFeseedAekAle---------
00471082   2/2  gnLppdvteedLrelFskfGevksv.kivrdketgkskgfafVeFese----------------------
00498011   1/2  ----------------------------------------------------------------------
00508391   1/2  ----------------------------------------------------------------------
00471972   2/2  grslkvgpsppspspeepppsrtlfvgnLppdvteedLrelFs---------------------------
00471081   1/2  ----------------------------------------------------------------------
00498431   1/2  ----------------------------------------------------------------------
00471971   1/2  ----------------------------------------------------------------------
00508392   2/2  skgfafVeFeseedaekalealngteldgrplrvelakpkeerg--------------------------
00494922   2/2  srgfafVeFeseedaekAlealngkelggrplrvelakpkeerg--------------------------
00524412   2/2  tgksrgfaFVeFeseedaekAlkalngteldgrplrvewakpkseleddgggl-----------------
00522182   2/2  llllllildketgkskgfafVeFespedaekAiealngkelggrk-------------------------
00474221   1/2  ----------------------------------------------------------------------
00522212   2/2  srgfafVeFeseedaekaleallngtelggrplrvelakpkeer--------------------------
00486822   2/2  skgfafVeFeseedaekAlealngkeldgrplrvelakpkeer---------------------------
00361652   2/2  skgfafVeFeseedaekalealngkllggrplrvelakpkeer---------------------------
00462872   2/2  srgfafVeFeseedaekalealngkllggrplrvelakpkeerd--------------------------
00498432   2/2  srgfafVefeseedaekale.lnglllggrplrvela---------------------------------
00508382   2/2  skgfafVeFedeedaekalealngkllggrplrvelakpkeerd--------------------------
00416532   2/2  gkskgfafVeFespedaekAlealngrkldgrplrvelakpkkerrgr----------------------
00522181   1/2  ----------------------------------------------------------------------
00416531   1/2  ----------------------------------------------------------------------
00533131   1/2  ----------------------------------------------------------------------
00378341   1/2  ----------------------------------------------------------------------
00508022   2/2  svrivrd....gkskgfafVeFedpedaekAiealngtelggrp--------------------------
00505662   2/2  srgfafVeFespedaekAlealngkeldgrplrvelakpkeerrrgggggg-------------------
00533132   2/2  skgfafVefedeedaekalealnglelggrplrvelakpkeerp--------------------------
00462871   1/2  ----------------------------------------------------------------------
00522361   1/2  ----------------------------------------------------------------------
00508061   1/2  ----------------------------------------------------------------------
00474222   2/2  skgfafVefeseedaekale.lnglllggrplrvelA---------------------------------
00526222   2/2  ....grsrgfafVeFedpedaekAlealngkelggrplrvelakpkeprlrlrggggggggggggggggg
00522402   2/2  skgfafVeFedeedaekAlealng.elggrplrvelakpkllrrlllgglpsgl----------------
00462861   1/2  ----------------------------------------------------------------------
00508092   2/2  skgfafVeFeseedaekalealngllllpgtlldgrplrvel----------------------------
00522352   2/2  ivrd...tgkskgfafVeFeseedaekAiealngkeldgrplrv--------------------------
00522391   1/2  ----------------------------------------------------------------------
00458931   1/2  ----------------------------------------------------------------------
00522382   2/2  srgfafVeFeseedaekalealngteldgrplrvelakpkeerg--------------------------
00522432   2/2  skgfafVeFeseedaekal..lngkelggrplrvklakpkeerg--------------------------
00522321   1/2  ----------------------------------------------------------------------
00467852   2/2  ..gkskgfafVeFedeedaekAlealngkeldgrplrvefak............................
00504662   2/2  vsgvrivrdk.tgkskGfafVeFeseedaekAl.alngkelggrplrvelakpkel--------------
00522362   2/2  Gevvsv.rivrdketgkskgfafVeFeseedaekAle.lngkel--------------------------
00471721   1/2  ----------------------------------------------------------------------
00522192   2/2  gkskgfafVeFespedaekAlealngklldgrklrvelakpkde--------------------------
00486821   1/2  ----------------------------------------------------------------------
00524411   1/2  ----------------------------------------------------------------------
00522312   2/2  srgfafVeFedpedaekAlealngkelggrplrvelakpkeerg--------------------------
00528991   1/2  ----------------------------------------------------------------------
00522211   1/2  ----------------------------------------------------------------------
00522351   1/2  ----------------------------------------------------------------------
00505141   1/2  ----------------------------------------------------------------------
00522401   1/2  ----------------------------------------------------------------------
00522291   1/2  ----------------------------------------------------------------------
00522451   1/2  ----------------------------------------------------------------------
00468761   1/2  ----------------------------------------------------------------------
00522311   1/2  ----------------------------------------------------------------------
00467851   1/2  ----------------------------------------------------------------------
00522381   1/2  ----------------------------------------------------------------------
00486802   2/2  skgfafVeFedeedaekAlealngkelggrplrvelakpkelrrglgggggggggg--------------
00522322   2/2  skgfafVeFeseedaekalealngklldgrplrvelakpkee----------------------------
00476311   1/2  ----------------------------------------------------------------------
00420612   2/2  .kgfafVeFedeaedaekAlealngtkldgrplrvewak...lkgerekellgkilggrgsrlgrrrggg
00522221   1/2  ----------------------------------------------------------------------
00528992   2/2  rskgfafVeFeseedaekAle.lngkllggrplrvelakpk-----------------------------
00522452   2/2  skgfafVeFedeedaekAlealngkeldgrplrvelakpkeerg--------------------------
00508062   2/2  skgfafVefeseedaekalealngllldgrllrV------------------------------------
00522172   2/2  .kgfafVeFedeedaekAlealngklldgrplrvelakpkedrp--------------------------
00505772   2/2  rskgfafVeFeseedaekAle.lngkelggrplrvelakpkeerrsgggg--------------------
00453731   1/2  ----------------------------------------------------------------------
00486801   1/2  ----------------------------------------------------------------------
00489841   1/2  ----------------------------------------------------------------------
00508372   2/2  srgfafVeFeseedaekalealngkeldgrplrvelakpkedrdg-------------------------
00508021   1/2  ----------------------------------------------------------------------
00522292   2/2  srgfafVeFeseedaekAlealngkelggrplrvelakpkeerr--------------------------
00528971   1/2  ----------------------------------------------------------------------
00526221   1/2  ----------------------------------------------------------------------
00522191   1/2  ----------------------------------------------------------------------
00508052   2/2  ..kgfAfVefeteedAeaalealnglglllggrplrvslskkke--------------------------
00504802   2/2  ..kgfafVeFedeedaekAiealngkelggrplrvelakpkserssgggg--------------------
00471722   2/2  skgfafVeFeseedaekale.lnglllggrllrvelA---------------------------------
00458932   2/2  srgfafVeFeseedaekalealngkllggrplrvelakpk------------------------------
00528972   2/2  srgfafVeFeseedaekaiealngkeldgrplrvelakpk------------------------------
00508371   1/2  ----------------------------------------------------------------------
00522431   1/2  ----------------------------------------------------------------------
00524421   1/2  ----------------------------------------------------------------------
00504772   2/2  ....kskgfafVeFenpedAakAlealngtellgkelkvefakpkslgssglappepgkq----------
00522442   2/2  srgfafVefedeedaekAlealngkllldgrplrvelakpkser--------------------------
00497752   2/2  dketgrskgfafVeFesvedaekAle.lngtelggrplrvklakp-------------------------
00505661   1/2  ----------------------------------------------------------------------
00462202   2/2  skgfafVeFedeedaekalealngkllggrplrvelakpk------------------------------
00497751   1/2  ----------------------------------------------------------------------
00494162   2/2  skgfafVeFedpedAekAlealngteldgrplrvefakskslrlsvgrg---------------------
00522302   2/2  skgfafVeFeseedaekAle.lngkelggrplrvelakpkelrealg-----------------------
00468762   2/2  srgfafVeFedeedaekalealngklldgrplrvelakpk------------------------------
00504791   1/2  ----------------------------------------------------------------------
00508341   1/2  ----------------------------------------------------------------------
00457472   2/2  ..gksrgfafVeFedeedaekAlealngkeldgrplrvelakpkedrrs---------------------
00476312   2/2  skgfafVeFeseedaekAiealngrelggrplkvela---------------------------------
00462201   1/2  ----------------------------------------------------------------------
00504661   1/2  ----------------------------------------------------------------------
00378342   2/2  srgfafVeFeseedaekalealngkllggrplrvelakp-------------------------------
00453732   2/2  srgfafVeFeseedaekale.lngkllggrllrvelA---------------------------------
00489842   2/2  ...kgfafVeFedeedaekAlealngkelggrplrvelakpkelrrsrgrgrsrglsrgrlrggllglgl
00428602   2/2  skgfafVeFeseedaekAlealngkelgggrplrvelakpk-----------------------------
00522222   2/2  tsgsgrsrgfafVtfeseedaekAiealngtlldg-----------------------------------
00508032   2/2  skgfafVeFeseedaekAle.lngtelggrplrvelakpkeere--------------------------
00517482   2/2  .kgfafVeFedeedaekAlealngkelllggrplrvelakpkelrlklglgg.-----------------
00462862   2/2  srgfafVeFedeedaekalealngkeldgrplrvelakpkedrrg-------------------------
00467942   2/2  srgfafVeFeseedaekAle.lngtelggrplrvelakpksdrggg------------------------
00508342   2/2  skgfafVeFespedaekAlealngkelggrplrvelakpkeer---------------------------
00420611   1/2  ----------------------------------------------------------------------
00454792   2/2  skgfafVeFedeedaekAlealngklllggrplkvef---------------------------------
00508031   1/2  ----------------------------------------------------------------------
00505152   2/2  evsv.rivrdk.tgkskgfafVeFeseedaekAle.lngkelggrplrve--------------------
00522232   2/2  .kgfafVeFedeedaekAlealngteldgrplrvelakpkeerd--------------------------
00484001   1/2  ----------------------------------------------------------------------
00428601   1/2  ----------------------------------------------------------------------
00467941   1/2  ----------------------------------------------------------------------
00528981   1/2  ----------------------------------------------------------------------
00505151   1/2  ----------------------------------------------------------------------
00522392   2/2  srgfafVeFeseedaekalealngklldgrplrV------------------------------------
00524422   2/2  svkvprd.....kskgfafVeFkdpedAekAiealng---------------------------------
00505771   1/2  ----------------------------------------------------------------------
00494161   1/2  ----------------------------------------------------------------------
00508091   1/2  ----------------------------------------------------------------------
00361651   1/2  ----------------------------------------------------------------------
00508381   1/2  ----------------------------------------------------------------------
00493341   1/2  ----------------------------------------------------------------------
00505142   2/2  vsv.rivrd.......gfafVeFedeedaekAlealngkeldsllgsl----------------------
00505681   1/2  ----------------------------------------------------------------------
00505671   1/2  ----------------------------------------------------------------------
00522482   2/2  skgfafVeFeseedaekAlealngkllggrplrvelA---------------------------------
00522342   2/2  .kgyafVeFeseedaekAiealngkelggrplrvewakpkserklll-----------------------
00493342   2/2  skgfafVeFeseedaekAle.lngkelggrplrvklakpkeerkrggrg---------------------
00484002   2/2  srgfafVefeseedaekAlealngkllggrplrvelakp-------------------------------
00522481   1/2  ----------------------------------------------------------------------
00505672   2/2  ...fafVeFedeedaekAlealngkeldgrplrvelak.rgrfgarpr----------------------
00494921   1/2  ----------------------------------------------------------------------
00505762   2/2  skgfafVefeseedaekAlealngtllggrplrvelakpkedrr--------------------------
00520821   1/2  ----------------------------------------------------------------------
00504812   2/2  .skgfafVeFedeedaekAiealngkeldgrplrvelakpkkergsgggg--------------------
00528982   2/2  skgfafVeFeseedaekAle.lngtllggrllrvelak--------------------------------
00505682   2/2  .kgfafVeFedeedaekAiealngkelggrplrvelakpkedrssg------------------------
00467952   2/2  skgfafVeFeseedaekAlealngkeldgrplrvelakpkeerrg-------------------------
00504792   2/2  skgfafVeFedeedaekAl..lngkeldgrplrvelakpkeerssglggg--------------------
00457471   1/2  ----------------------------------------------------------------------
00508081   1/2  ----------------------------------------------------------------------
00508041   1/2  ----------------------------------------------------------------------
00522171   1/2  ----------------------------------------------------------------------
00522331   1/2  ----------------------------------------------------------------------
00504782   2/2  skgfafVeFaseedaekAlk.lngtelggrpirvelaspkellrvlgsgg--------------------
00508082   2/2  .kgfafVeFeseedaekAlealngkeldgrplrvelakpkeerp--------------------------
00508042   2/2  ..gfafVeFeseedaekAieklngteldgrrlrvelarpkerrrsslgrggggg----------------
00504801   1/2  ----------------------------------------------------------------------
00522441   1/2  ----------------------------------------------------------------------
00522231   1/2  ----------------------------------------------------------------------
00505652   2/2  skgfAfVefespesAqaAiealnglellgrplkvkfakskeerlsgkssgdsl-----------------
00517481   1/2  ----------------------------------------------------------------------
00504781   1/2  ----------------------------------------------------------------------
00467951   1/2  ----------------------------------------------------------------------
00522341   1/2  ----------------------------------------------------------------------
00498882   2/2  v.........kgyafVeFadeesaekAl.alngrelggrp------------------------------
00498881   1/2  ----------------------------------------------------------------------
00504761   1/2  ----------------------------------------------------------------------
00520822   2/2  .rgfafVefedpedaekAiealngkelggrplrvelakpkse----------------------------
00522332   2/2  .kgfAfVeFedeedaekAlealngtplllggrplrvefakpkel--------------------------
00454791   1/2  ----------------------------------------------------------------------
00508071   1/2  ----------------------------------------------------------------------
00505761   1/2  ----------------------------------------------------------------------
00524292   2/2  skgfafVefesledalkAiealnglllggrplrvslaksk------------------------------
00504771   1/2  ----------------------------------------------------------------------
00504811   1/2  ----------------------------------------------------------------------
00522301   1/2  ----------------------------------------------------------------------
00508051   1/2  ----------------------------------------------------------------------
00504762   2/2  .kgfAfVeFeseedaekAlealngtplllggrplrveyakpkelllsgngsgs-----------------
00508072   2/2  ..kgfAfVefetredAeaAiealslngkelggrplrvefakpk---------------------------
00505651   1/2  ----------------------------------------------------------------------
00505122   2/2  skgfafVefeneedaqkAiealngtelkgrplvVelakpkelrlsgpssg--------------------
00524291   1/2  ----------------------------------------------------------------------
00505121   1/2  ----------------------------------------------------------------------
00507271   1/2  ----------------------------------------------------------------------
00507272   2/2  .kgfafvefeskesAekAl.elngkvlggrlllkvelakdkslq--------------------------
00445422   2/2  kpskysrayvnfkspedavefikaldg-------------------------------------------
00445421   1/2  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           FSDVPLGVPANTPLAMPGVHAAIAAHATGRPGYQPPPLMGMAQSGYQGQYPPVPPPPPSVTPMPPPMPPT
00497691   1/1  ----------------------------------------------------------------------
00498012   2/2  ----------------------------------------------------------------------
00471082   2/2  ----------------------------------------------------------------------
00498011   1/2  ----------------------------------------------------------------------
00508391   1/2  ----------------------------------------------------------------------
00471972   2/2  ----------------------------------------------------------------------
00471081   1/2  ----------------------------------------------------------------------
00498431   1/2  ----------------------------------------------------------------------
00471971   1/2  ----------------------------------------------------------------------
00508392   2/2  ----------------------------------------------------------------------
00494922   2/2  ----------------------------------------------------------------------
00524412   2/2  ----------------------------------------------------------------------
00522182   2/2  ----------------------------------------------------------------------
00474221   1/2  ----------------------------------------------------------------------
00522212   2/2  ----------------------------------------------------------------------
00486822   2/2  ----------------------------------------------------------------------
00361652   2/2  ----------------------------------------------------------------------
00462872   2/2  ----------------------------------------------------------------------
00498432   2/2  ----------------------------------------------------------------------
00508382   2/2  ----------------------------------------------------------------------
00416532   2/2  ----------------------------------------------------------------------
00522181   1/2  ----------------------------------------------------------------------
00416531   1/2  ----------------------------------------------------------------------
00533131   1/2  ----------------------------------------------------------------------
00378341   1/2  ----------------------------------------------------------------------
00508022   2/2  ----------------------------------------------------------------------
00505662   2/2  ----------------------------------------------------------------------
00533132   2/2  ----------------------------------------------------------------------
00462871   1/2  ----------------------------------------------------------------------
00522361   1/2  ----------------------------------------------------------------------
00508061   1/2  ----------------------------------------------------------------------
00474222   2/2  ----------------------------------------------------------------------
00526222   2/2  ----------------------------------------------------------------------
00522402   2/2  ----------------------------------------------------------------------
00462861   1/2  ----------------------------------------------------------------------
00508092   2/2  ----------------------------------------------------------------------
00522352   2/2  ----------------------------------------------------------------------
00522391   1/2  ----------------------------------------------------------------------
00458931   1/2  ----------------------------------------------------------------------
00522382   2/2  ----------------------------------------------------------------------
00522432   2/2  ----------------------------------------------------------------------
00522321   1/2  ----------------------------------------------------------------------
00467852   2/2  ......................................................................
00504662   2/2  ----------------------------------------------------------------------
00522362   2/2  ----------------------------------------------------------------------
00471721   1/2  ----------------------------------------------------------------------
00522192   2/2  ----------------------------------------------------------------------
00486821   1/2  ----------------------------------------------------------------------
00524411   1/2  ----------------------------------------------------------------------
00522312   2/2  ----------------------------------------------------------------------
00528991   1/2  ----------------------------------------------------------------------
00522211   1/2  ----------------------------------------------------------------------
00522351   1/2  ----------------------------------------------------------------------
00505141   1/2  ----------------------------------------------------------------------
00522401   1/2  ----------------------------------------------------------------------
00522291   1/2  ----------------------------------------------------------------------
00522451   1/2  ----------------------------------------------------------------------
00468761   1/2  ----------------------------------------------------------------------
00522311   1/2  ----------------------------------------------------------------------
00467851   1/2  ----------------------------------------------------------------------
00522381   1/2  ----------------------------------------------------------------------
00486802   2/2  ----------------------------------------------------------------------
00522322   2/2  ----------------------------------------------------------------------
00476311   1/2  ----------------------------------------------------------------------
00420612   2/2  ----------------------------------------------------------------------
00522221   1/2  ----------------------------------------------------------------------
00528992   2/2  ----------------------------------------------------------------------
00522452   2/2  ----------------------------------------------------------------------
00508062   2/2  ----------------------------------------------------------------------
00522172   2/2  ----------------------------------------------------------------------
00505772   2/2  ----------------------------------------------------------------------
00453731   1/2  ----------------------------------------------------------------------
00486801   1/2  ----------------------------------------------------------------------
00489841   1/2  ----------------------------------------------------------------------
00508372   2/2  ----------------------------------------------------------------------
00508021   1/2  ----------------------------------------------------------------------
00522292   2/2  ----------------------------------------------------------------------
00528971   1/2  ----------------------------------------------------------------------
00526221   1/2  ----------------------------------------------------------------------
00522191   1/2  ----------------------------------------------------------------------
00508052   2/2  ----------------------------------------------------------------------
00504802   2/2  ----------------------------------------------------------------------
00471722   2/2  ----------------------------------------------------------------------
00458932   2/2  ----------------------------------------------------------------------
00528972   2/2  ----------------------------------------------------------------------
00508371   1/2  ----------------------------------------------------------------------
00522431   1/2  ----------------------------------------------------------------------
00524421   1/2  ----------------------------------------------------------------------
00504772   2/2  ----------------------------------------------------------------------
00522442   2/2  ----------------------------------------------------------------------
00497752   2/2  ----------------------------------------------------------------------
00505661   1/2  ----------------------------------------------------------------------
00462202   2/2  ----------------------------------------------------------------------
00497751   1/2  ----------------------------------------------------------------------
00494162   2/2  ----------------------------------------------------------------------
00522302   2/2  ----------------------------------------------------------------------
00468762   2/2  ----------------------------------------------------------------------
00504791   1/2  ----------------------------------------------------------------------
00508341   1/2  ----------------------------------------------------------------------
00457472   2/2  ----------------------------------------------------------------------
00476312   2/2  ----------------------------------------------------------------------
00462201   1/2  ----------------------------------------------------------------------
00504661   1/2  ----------------------------------------------------------------------
00378342   2/2  ----------------------------------------------------------------------
00453732   2/2  ----------------------------------------------------------------------
00489842   2/2  gg--------------------------------------------------------------------
00428602   2/2  ----------------------------------------------------------------------
00522222   2/2  ----------------------------------------------------------------------
00508032   2/2  ----------------------------------------------------------------------
00517482   2/2  ----------------------------------------------------------------------
00462862   2/2  ----------------------------------------------------------------------
00467942   2/2  ----------------------------------------------------------------------
00508342   2/2  ----------------------------------------------------------------------
00420611   1/2  ----------------------------------------------------------------------
00454792   2/2  ----------------------------------------------------------------------
00508031   1/2  ----------------------------------------------------------------------
00505152   2/2  ----------------------------------------------------------------------
00522232   2/2  ----------------------------------------------------------------------
00484001   1/2  ----------------------------------------------------------------------
00428601   1/2  ----------------------------------------------------------------------
00467941   1/2  ----------------------------------------------------------------------
00528981   1/2  ----------------------------------------------------------------------
00505151   1/2  ----------------------------------------------------------------------
00522392   2/2  ----------------------------------------------------------------------
00524422   2/2  ----------------------------------------------------------------------
00505771   1/2  ----------------------------------------------------------------------
00494161   1/2  ----------------------------------------------------------------------
00508091   1/2  ----------------------------------------------------------------------
00361651   1/2  ----------------------------------------------------------------------
00508381   1/2  ----------------------------------------------------------------------
00493341   1/2  ----------------------------------------------------------------------
00505142   2/2  ----------------------------------------------------------------------
00505681   1/2  ----------------------------------------------------------------------
00505671   1/2  ----------------------------------------------------------------------
00522482   2/2  ----------------------------------------------------------------------
00522342   2/2  ----------------------------------------------------------------------
00493342   2/2  ----------------------------------------------------------------------
00484002   2/2  ----------------------------------------------------------------------
00522481   1/2  ----------------------------------------------------------------------
00505672   2/2  ----------------------------------------------------------------------
00494921   1/2  ----------------------------------------------------------------------
00505762   2/2  ----------------------------------------------------------------------
00520821   1/2  ----------------------------------------------------------------------
00504812   2/2  ----------------------------------------------------------------------
00528982   2/2  ----------------------------------------------------------------------
00505682   2/2  ----------------------------------------------------------------------
00467952   2/2  ----------------------------------------------------------------------
00504792   2/2  ----------------------------------------------------------------------
00457471   1/2  ----------------------------------------------------------------------
00508081   1/2  ----------------------------------------------------------------------
00508041   1/2  ----------------------------------------------------------------------
00522171   1/2  ----------------------------------------------------------------------
00522331   1/2  ----------------------------------------------------------------------
00504782   2/2  ----------------------------------------------------------------------
00508082   2/2  ----------------------------------------------------------------------
00508042   2/2  ----------------------------------------------------------------------
00504801   1/2  ----------------------------------------------------------------------
00522441   1/2  ----------------------------------------------------------------------
00522231   1/2  ----------------------------------------------------------------------
00505652   2/2  ----------------------------------------------------------------------
00517481   1/2  ----------------------------------------------------------------------
00504781   1/2  ----------------------------------------------------------------------
00467951   1/2  ----------------------------------------------------------------------
00522341   1/2  ----------------------------------------------------------------------
00498882   2/2  ----------------------------------------------------------------------
00498881   1/2  ----------------------------------------------------------------------
00504761   1/2  ----------------------------------------------------------------------
00520822   2/2  ----------------------------------------------------------------------
00522332   2/2  ----------------------------------------------------------------------
00454791   1/2  ----------------------------------------------------------------------
00508071   1/2  ----------------------------------------------------------------------
00505761   1/2  ----------------------------------------------------------------------
00524292   2/2  ----------------------------------------------------------------------
00504771   1/2  ----------------------------------------------------------------------
00504811   1/2  ----------------------------------------------------------------------
00522301   1/2  ----------------------------------------------------------------------
00508051   1/2  ----------------------------------------------------------------------
00504762   2/2  ----------------------------------------------------------------------
00508072   2/2  ----------------------------------------------------------------------
00505651   1/2  ----------------------------------------------------------------------
00505122   2/2  ----------------------------------------------------------------------
00524291   1/2  ----------------------------------------------------------------------
00505121   1/2  ----------------------------------------------------------------------
00507271   1/2  ----------------------------------------------------------------------
00507272   2/2  ----------------------------------------------------------------------
00445422   2/2  ----------------------------------------------------------------------
00445421   1/2  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           PGMTPRPPPPPSSGMWPPPPPPPPGRTPGPPGMPGMPPPPPPSRFGPPGMGGMPPPPPPGMRYPGGMPPP
00497691   1/1  ----------------------------------------------------------------------
00498012   2/2  ----------------------------------------------------------------------
00471082   2/2  ----------------------------------------------------------------------
00498011   1/2  ----------------------------------------------------------------------
00508391   1/2  ----------------------------------------------------------------------
00471972   2/2  ----------------------------------------------------------------------
00471081   1/2  ----------------------------------------------------------------------
00498431   1/2  ----------------------------------------------------------------------
00471971   1/2  ----------------------------------------------------------------------
00508392   2/2  ----------------------------------------------------------------------
00494922   2/2  ----------------------------------------------------------------------
00524412   2/2  ----------------------------------------------------------------------
00522182   2/2  ----------------------------------------------------------------------
00474221   1/2  ----------------------------------------------------------------------
00522212   2/2  ----------------------------------------------------------------------
00486822   2/2  ----------------------------------------------------------------------
00361652   2/2  ----------------------------------------------------------------------
00462872   2/2  ----------------------------------------------------------------------
00498432   2/2  ----------------------------------------------------------------------
00508382   2/2  ----------------------------------------------------------------------
00416532   2/2  ----------------------------------------------------------------------
00522181   1/2  ----------------------------------------------------------------------
00416531   1/2  ----------------------------------------------------------------------
00533131   1/2  ----------------------------------------------------------------------
00378341   1/2  ----------------------------------------------------------------------
00508022   2/2  ----------------------------------------------------------------------
00505662   2/2  ----------------------------------------------------------------------
00533132   2/2  ----------------------------------------------------------------------
00462871   1/2  ----------------------------------------------------------------------
00522361   1/2  ----------------------------------------------------------------------
00508061   1/2  ----------------------------------------------------------------------
00474222   2/2  ----------------------------------------------------------------------
00526222   2/2  ----------------------------------------------------------------------
00522402   2/2  ----------------------------------------------------------------------
00462861   1/2  ----------------------------------------------------------------------
00508092   2/2  ----------------------------------------------------------------------
00522352   2/2  ----------------------------------------------------------------------
00522391   1/2  ----------------------------------------------------------------------
00458931   1/2  ----------------------------------------------------------------------
00522382   2/2  ----------------------------------------------------------------------
00522432   2/2  ----------------------------------------------------------------------
00522321   1/2  ----------------------------------------------------------------------
00467852   2/2  ....pkslrrgrgggrsggrgggrggggg-----------------------------------------
00504662   2/2  ----------------------------------------------------------------------
00522362   2/2  ----------------------------------------------------------------------
00471721   1/2  ----------------------------------------------------------------------
00522192   2/2  ----------------------------------------------------------------------
00486821   1/2  ----------------------------------------------------------------------
00524411   1/2  ----------------------------------------------------------------------
00522312   2/2  ----------------------------------------------------------------------
00528991   1/2  ----------------------------------------------------------------------
00522211   1/2  ----------------------------------------------------------------------
00522351   1/2  ----------------------------------------------------------------------
00505141   1/2  ----------------------------------------------------------------------
00522401   1/2  ----------------------------------------------------------------------
00522291   1/2  ----------------------------------------------------------------------
00522451   1/2  ----------------------------------------------------------------------
00468761   1/2  ----------------------------------------------------------------------
00522311   1/2  ----------------------------------------------------------------------
00467851   1/2  ----------------------------------------------------------------------
00522381   1/2  ----------------------------------------------------------------------
00486802   2/2  ----------------------------------------------------------------------
00522322   2/2  ----------------------------------------------------------------------
00476311   1/2  ----------------------------------------------------------------------
00420612   2/2  ----------------------------------------------------------------------
00522221   1/2  ----------------------------------------------------------------------
00528992   2/2  ----------------------------------------------------------------------
00522452   2/2  ----------------------------------------------------------------------
00508062   2/2  ----------------------------------------------------------------------
00522172   2/2  ----------------------------------------------------------------------
00505772   2/2  ----------------------------------------------------------------------
00453731   1/2  ----------------------------------------------------------------------
00486801   1/2  ----------------------------------------------------------------------
00489841   1/2  ----------------------------------------------------------------------
00508372   2/2  ----------------------------------------------------------------------
00508021   1/2  ----------------------------------------------------------------------
00522292   2/2  ----------------------------------------------------------------------
00528971   1/2  ----------------------------------------------------------------------
00526221   1/2  ----------------------------------------------------------------------
00522191   1/2  ----------------------------------------------------------------------
00508052   2/2  ----------------------------------------------------------------------
00504802   2/2  ----------------------------------------------------------------------
00471722   2/2  ----------------------------------------------------------------------
00458932   2/2  ----------------------------------------------------------------------
00528972   2/2  ----------------------------------------------------------------------
00508371   1/2  ----------------------------------------------------------------------
00522431   1/2  ----------------------------------------------------------------------
00524421   1/2  ----------------------------------------------------------------------
00504772   2/2  ----------------------------------------------------------------------
00522442   2/2  ----------------------------------------------------------------------
00497752   2/2  ----------------------------------------------------------------------
00505661   1/2  ----------------------------------------------------------------------
00462202   2/2  ----------------------------------------------------------------------
00497751   1/2  ----------------------------------------------------------------------
00494162   2/2  ----------------------------------------------------------------------
00522302   2/2  ----------------------------------------------------------------------
00468762   2/2  ----------------------------------------------------------------------
00504791   1/2  ----------------------------------------------------------------------
00508341   1/2  ----------------------------------------------------------------------
00457472   2/2  ----------------------------------------------------------------------
00476312   2/2  ----------------------------------------------------------------------
00462201   1/2  ----------------------------------------------------------------------
00504661   1/2  ----------------------------------------------------------------------
00378342   2/2  ----------------------------------------------------------------------
00453732   2/2  ----------------------------------------------------------------------
00489842   2/2  ----------------------------------------------------------------------
00428602   2/2  ----------------------------------------------------------------------
00522222   2/2  ----------------------------------------------------------------------
00508032   2/2  ----------------------------------------------------------------------
00517482   2/2  ----------------------------------------------------------------------
00462862   2/2  ----------------------------------------------------------------------
00467942   2/2  ----------------------------------------------------------------------
00508342   2/2  ----------------------------------------------------------------------
00420611   1/2  ----------------------------------------------------------------------
00454792   2/2  ----------------------------------------------------------------------
00508031   1/2  ----------------------------------------------------------------------
00505152   2/2  ----------------------------------------------------------------------
00522232   2/2  ----------------------------------------------------------------------
00484001   1/2  ----------------------------------------------------------------------
00428601   1/2  ----------------------------------------------------------------------
00467941   1/2  ----------------------------------------------------------------------
00528981   1/2  ----------------------------------------------------------------------
00505151   1/2  ----------------------------------------------------------------------
00522392   2/2  ----------------------------------------------------------------------
00524422   2/2  ----------------------------------------------------------------------
00505771   1/2  ----------------------------------------------------------------------
00494161   1/2  ----------------------------------------------------------------------
00508091   1/2  ----------------------------------------------------------------------
00361651   1/2  ----------------------------------------------------------------------
00508381   1/2  ----------------------------------------------------------------------
00493341   1/2  ----------------------------------------------------------------------
00505142   2/2  ----------------------------------------------------------------------
00505681   1/2  ----------------------------------------------------------------------
00505671   1/2  ----------------------------------------------------------------------
00522482   2/2  ----------------------------------------------------------------------
00522342   2/2  ----------------------------------------------------------------------
00493342   2/2  ----------------------------------------------------------------------
00484002   2/2  ----------------------------------------------------------------------
00522481   1/2  ----------------------------------------------------------------------
00505672   2/2  ----------------------------------------------------------------------
00494921   1/2  ----------------------------------------------------------------------
00505762   2/2  ----------------------------------------------------------------------
00520821   1/2  ----------------------------------------------------------------------
00504812   2/2  ----------------------------------------------------------------------
00528982   2/2  ----------------------------------------------------------------------
00505682   2/2  ----------------------------------------------------------------------
00467952   2/2  ----------------------------------------------------------------------
00504792   2/2  ----------------------------------------------------------------------
00457471   1/2  ----------------------------------------------------------------------
00508081   1/2  ----------------------------------------------------------------------
00508041   1/2  ----------------------------------------------------------------------
00522171   1/2  ----------------------------------------------------------------------
00522331   1/2  ----------------------------------------------------------------------
00504782   2/2  ----------------------------------------------------------------------
00508082   2/2  ----------------------------------------------------------------------
00508042   2/2  ----------------------------------------------------------------------
00504801   1/2  ----------------------------------------------------------------------
00522441   1/2  ----------------------------------------------------------------------
00522231   1/2  ----------------------------------------------------------------------
00505652   2/2  ----------------------------------------------------------------------
00517481   1/2  ----------------------------------------------------------------------
00504781   1/2  ----------------------------------------------------------------------
00467951   1/2  ----------------------------------------------------------------------
00522341   1/2  ----------------------------------------------------------------------
00498882   2/2  ----------------------------------------------------------------------
00498881   1/2  ----------------------------------------------------------------------
00504761   1/2  ----------------------------------------------------------------------
00520822   2/2  ----------------------------------------------------------------------
00522332   2/2  ----------------------------------------------------------------------
00454791   1/2  ----------------------------------------------------------------------
00508071   1/2  ----------------------------------------------------------------------
00505761   1/2  ----------------------------------------------------------------------
00524292   2/2  ----------------------------------------------------------------------
00504771   1/2  ----------------------------------------------------------------------
00504811   1/2  ----------------------------------------------------------------------
00522301   1/2  ----------------------------------------------------------------------
00508051   1/2  ----------------------------------------------------------------------
00504762   2/2  ----------------------------------------------------------------------
00508072   2/2  ----------------------------------------------------------------------
00505651   1/2  ----------------------------------------------------------------------
00505122   2/2  ----------------------------------------------------------------------
00524291   1/2  ----------------------------------------------------------------------
00505121   1/2  ----------------------------------------------------------------------
00507271   1/2  ----------------------------------------------------------------------
00507272   2/2  ----------------------------------------------------------------------
00445422   2/2  ----------------------------------------------------------------------
00445421   1/2  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           PPPRYPSAGPGMYPPPPPSRPPAPPSGHGMIPPPPPPS--------------------------------
00497691   1/1  ----------------------------------------------------------------------
00498012   2/2  ----------------------------------------------------------------------
00471082   2/2  ----------------------------------------------------------------------
00498011   1/2  ----------------------------------------------------------------------
00508391   1/2  ----------------------------------------------------------------------
00471972   2/2  ----------------------------------------------------------------------
00471081   1/2  ----------------------------------------------------------------------
00498431   1/2  ----------------------------------------------------------------------
00471971   1/2  ----------------------------------------------------------------------
00508392   2/2  ----------------------------------------------------------------------
00494922   2/2  ----------------------------------------------------------------------
00524412   2/2  ----------------------------------------------------------------------
00522182   2/2  ----------------------------------------------------------------------
00474221   1/2  ----------------------------------------------------------------------
00522212   2/2  ----------------------------------------------------------------------
00486822   2/2  ----------------------------------------------------------------------
00361652   2/2  ----------------------------------------------------------------------
00462872   2/2  ----------------------------------------------------------------------
00498432   2/2  ----------------------------------------------------------------------
00508382   2/2  ----------------------------------------------------------------------
00416532   2/2  ----------------------------------------------------------------------
00522181   1/2  ----------------------------------------------------------------------
00416531   1/2  ----------------------------------------------------------------------
00533131   1/2  ----------------------------------------------------------------------
00378341   1/2  ----------------------------------------------------------------------
00508022   2/2  ----------------------------------------------------------------------
00505662   2/2  ----------------------------------------------------------------------
00533132   2/2  ----------------------------------------------------------------------
00462871   1/2  ----------------------------------------------------------------------
00522361   1/2  ----------------------------------------------------------------------
00508061   1/2  ----------------------------------------------------------------------
00474222   2/2  ----------------------------------------------------------------------
00526222   2/2  ----------------------------------------------------------------------
00522402   2/2  ----------------------------------------------------------------------
00462861   1/2  ----------------------------------------------------------------------
00508092   2/2  ----------------------------------------------------------------------
00522352   2/2  ----------------------------------------------------------------------
00522391   1/2  ----------------------------------------------------------------------
00458931   1/2  ----------------------------------------------------------------------
00522382   2/2  ----------------------------------------------------------------------
00522432   2/2  ----------------------------------------------------------------------
00522321   1/2  ----------------------------------------------------------------------
00467852   2/2  ----------------------------------------------------------------------
00504662   2/2  ----------------------------------------------------------------------
00522362   2/2  ----------------------------------------------------------------------
00471721   1/2  ----------------------------------------------------------------------
00522192   2/2  ----------------------------------------------------------------------
00486821   1/2  ----------------------------------------------------------------------
00524411   1/2  ----------------------------------------------------------------------
00522312   2/2  ----------------------------------------------------------------------
00528991   1/2  ----------------------------------------------------------------------
00522211   1/2  ----------------------------------------------------------------------
00522351   1/2  ----------------------------------------------------------------------
00505141   1/2  ----------------------------------------------------------------------
00522401   1/2  ----------------------------------------------------------------------
00522291   1/2  ----------------------------------------------------------------------
00522451   1/2  ----------------------------------------------------------------------
00468761   1/2  ----------------------------------------------------------------------
00522311   1/2  ----------------------------------------------------------------------
00467851   1/2  ----------------------------------------------------------------------
00522381   1/2  ----------------------------------------------------------------------
00486802   2/2  ----------------------------------------------------------------------
00522322   2/2  ----------------------------------------------------------------------
00476311   1/2  ----------------------------------------------------------------------
00420612   2/2  ----------------------------------------------------------------------
00522221   1/2  ----------------------------------------------------------------------
00528992   2/2  ----------------------------------------------------------------------
00522452   2/2  ----------------------------------------------------------------------
00508062   2/2  ----------------------------------------------------------------------
00522172   2/2  ----------------------------------------------------------------------
00505772   2/2  ----------------------------------------------------------------------
00453731   1/2  ----------------------------------------------------------------------
00486801   1/2  ----------------------------------------------------------------------
00489841   1/2  ----------------------------------------------------------------------
00508372   2/2  ----------------------------------------------------------------------
00508021   1/2  ----------------------------------------------------------------------
00522292   2/2  ----------------------------------------------------------------------
00528971   1/2  ----------------------------------------------------------------------
00526221   1/2  ----------------------------------------------------------------------
00522191   1/2  ----------------------------------------------------------------------
00508052   2/2  ----------------------------------------------------------------------
00504802   2/2  ----------------------------------------------------------------------
00471722   2/2  ----------------------------------------------------------------------
00458932   2/2  ----------------------------------------------------------------------
00528972   2/2  ----------------------------------------------------------------------
00508371   1/2  ----------------------------------------------------------------------
00522431   1/2  ----------------------------------------------------------------------
00524421   1/2  ----------------------------------------------------------------------
00504772   2/2  ----------------------------------------------------------------------
00522442   2/2  ----------------------------------------------------------------------
00497752   2/2  ----------------------------------------------------------------------
00505661   1/2  ----------------------------------------------------------------------
00462202   2/2  ----------------------------------------------------------------------
00497751   1/2  ----------------------------------------------------------------------
00494162   2/2  ----------------------------------------------------------------------
00522302   2/2  ----------------------------------------------------------------------
00468762   2/2  ----------------------------------------------------------------------
00504791   1/2  ----------------------------------------------------------------------
00508341   1/2  ----------------------------------------------------------------------
00457472   2/2  ----------------------------------------------------------------------
00476312   2/2  ----------------------------------------------------------------------
00462201   1/2  ----------------------------------------------------------------------
00504661   1/2  ----------------------------------------------------------------------
00378342   2/2  ----------------------------------------------------------------------
00453732   2/2  ----------------------------------------------------------------------
00489842   2/2  ----------------------------------------------------------------------
00428602   2/2  ----------------------------------------------------------------------
00522222   2/2  ----------------------------------------------------------------------
00508032   2/2  ----------------------------------------------------------------------
00517482   2/2  ----------------------------------------------------------------------
00462862   2/2  ----------------------------------------------------------------------
00467942   2/2  ----------------------------------------------------------------------
00508342   2/2  ----------------------------------------------------------------------
00420611   1/2  ----------------------------------------------------------------------
00454792   2/2  ----------------------------------------------------------------------
00508031   1/2  ----------------------------------------------------------------------
00505152   2/2  ----------------------------------------------------------------------
00522232   2/2  ----------------------------------------------------------------------
00484001   1/2  ----------------------------------------------------------------------
00428601   1/2  ----------------------------------------------------------------------
00467941   1/2  ----------------------------------------------------------------------
00528981   1/2  ----------------------------------------------------------------------
00505151   1/2  ----------------------------------------------------------------------
00522392   2/2  ----------------------------------------------------------------------
00524422   2/2  ----------------------------------------------------------------------
00505771   1/2  ----------------------------------------------------------------------
00494161   1/2  ----------------------------------------------------------------------
00508091   1/2  ----------------------------------------------------------------------
00361651   1/2  ----------------------------------------------------------------------
00508381   1/2  ----------------------------------------------------------------------
00493341   1/2  ----------------------------------------------------------------------
00505142   2/2  ----------------------------------------------------------------------
00505681   1/2  ----------------------------------------------------------------------
00505671   1/2  ----------------------------------------------------------------------
00522482   2/2  ----------------------------------------------------------------------
00522342   2/2  ----------------------------------------------------------------------
00493342   2/2  ----------------------------------------------------------------------
00484002   2/2  ----------------------------------------------------------------------
00522481   1/2  ----------------------------------------------------------------------
00505672   2/2  ----------------------------------------------------------------------
00494921   1/2  ----------------------------------------------------------------------
00505762   2/2  ----------------------------------------------------------------------
00520821   1/2  ----------------------------------------------------------------------
00504812   2/2  ----------------------------------------------------------------------
00528982   2/2  ----------------------------------------------------------------------
00505682   2/2  ----------------------------------------------------------------------
00467952   2/2  ----------------------------------------------------------------------
00504792   2/2  ----------------------------------------------------------------------
00457471   1/2  ----------------------------------------------------------------------
00508081   1/2  ----------------------------------------------------------------------
00508041   1/2  ----------------------------------------------------------------------
00522171   1/2  ----------------------------------------------------------------------
00522331   1/2  ----------------------------------------------------------------------
00504782   2/2  ----------------------------------------------------------------------
00508082   2/2  ----------------------------------------------------------------------
00508042   2/2  ----------------------------------------------------------------------
00504801   1/2  ----------------------------------------------------------------------
00522441   1/2  ----------------------------------------------------------------------
00522231   1/2  ----------------------------------------------------------------------
00505652   2/2  ----------------------------------------------------------------------
00517481   1/2  ----------------------------------------------------------------------
00504781   1/2  ----------------------------------------------------------------------
00467951   1/2  ----------------------------------------------------------------------
00522341   1/2  ----------------------------------------------------------------------
00498882   2/2  ----------------------------------------------------------------------
00498881   1/2  ----------------------------------------------------------------------
00504761   1/2  ----------------------------------------------------------------------
00520822   2/2  ----------------------------------------------------------------------
00522332   2/2  ----------------------------------------------------------------------
00454791   1/2  ----------------------------------------------------------------------
00508071   1/2  ----------------------------------------------------------------------
00505761   1/2  ----------------------------------------------------------------------
00524292   2/2  ----------------------------------------------------------------------
00504771   1/2  ----------------------------------------------------------------------
00504811   1/2  ----------------------------------------------------------------------
00522301   1/2  ----------------------------------------------------------------------
00508051   1/2  ----------------------------------------------------------------------
00504762   2/2  ----------------------------------------------------------------------
00508072   2/2  ----------------------------------------------------------------------
00505651   1/2  ----------------------------------------------------------------------
00505122   2/2  ----------------------------------------------------------------------
00524291   1/2  ----------------------------------------------------------------------
00505121   1/2  ----------------------------------------------------------------------
00507271   1/2  ----------------------------------------------------------------------
00507272   2/2  ----------------------------------------------------------------------
00445422   2/2  ----------------------------------------------------------------------
00445421   1/2  ----------------------------------------------------------------------