[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cglu2:BAF52967.1


[Show Plain Result]

## Summary of Sequence Search
   1::684
 265::434  PF00204 0.0% 53.2544378698225  DNA gyrase B 
 611::672  PF00986 0.0% 62.9032258064516  DNA gyrase B subunit, carboxyl terminus 
  35::172  PF02518 0.0% 28.8461538461538  Histidine kinase-, DNA gyrase B-, and HSP90-like AT 
 463::562  PF01751 0.0% 25  Toprim domain 
   1::684


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MANTEHNYDASSITILEGLEAVRKRPGMYIGSTGPRGLHHLIWEVVDNSVDEAMAGHATKVEVTLLEDGG
PF00204         ----------------------------------------------------------------------
PF00986         ----------------------------------------------------------------------
PF02518         ----------------------------------edrlrqivselvdNavkatees..geievrvkreeg
PF01751         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           VQVVDDGRGIPVDMHPSGAPTVQVVMTQLHAGGKFDSDSYAVSGGLHGVGISVVNALSTRVEADIKLHGK
PF00204         ----------------------------------------------------------------------
PF00986         ----------------------------------------------------------------------
PF02518         elvieVeDnGiGipe..........edlervfepffqtdddsrkvgg..tGlGlsivkklvellggeiev
PF01751         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           HWYQNFEKSVPDELIEGGNARGTGTTIRFWPDAEIFETTEFDFETISRRLQEMAFLNKGLTITLTDNRAT
PF00204         ----------------------------------------------------------------------
PF00986         ----------------------------------------------------------------------
PF02518         eske....................ggGttvtl--------------------------------------
PF01751         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           DEELELEALAEQGETATELSLDEIDNETELVEETTDAPKKPKKREKKKIFHYPNGLEDYVQYLNRSKTNI
PF00204         ------------------------------------------------------glkdyveelnkdkktl
PF00986         ----------------------------------------------------------------------
PF02518         ----------------------------------------------------------------------
PF01751         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           HPSIVSFEAKGDDHEVEVAMQWNSSYKESVHTFANTINTREGGTHEEGFRSALTSLMNRYAREHKLLKEK
PF00204         hsevisiegekaeeekievevalqwndsysenivsFvNnintpeGGtHvdgfkaaltkalneyakkkkll
PF00986         ----------------------------------------------------------------------
PF02518         ----------------------------------------------------------------------
PF01751         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           EANLTGDDCREGLSAVISVRVGDPQFEGQTKTKLGNTEIKSFVQRMANEHIGHWLEANPAEAKVIINKAV
PF00204         kkkk.kitgediregltavvsvkipnpqFegQTKekLtnsevksivekvvseklekfleknpeiakkile
PF00986         ----------------------------------------------------------------------
PF02518         ----------------------------------------------------------------------
PF01751         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           GSAQARLAARKARDLVRRKSATDLGGLPGKLADCRSKDPEKSELYIVEGDSAGGSAKSGRDSMFQAILPL
PF00204         kalaaakarlaark--------------------------------------------------------
PF00986         ----------------------------------------------------------------------
PF02518         ----------------------------------------------------------------------
PF01751         ------------------------------------------vliivEgpsdakaiakalg.........


                         *         -         -         -         -         +         -:560
query           RGKILNVEKARLDKVLKNAEVQAIITALGTGIHDEFDINKLRYHKIVLMADADVDGQHIATLLLTLLFRF
PF00204         ----------------------------------------------------------------------
PF00986         ----------------------------------------------------------------------
PF02518         ----------------------------------------------------------------------
PF01751         ...................keltvtaslGhlvdldtkekkkkdkkevlkllkelakeadeviiatDpDre


                         -         -         -         *         -         -         -:630
query           MPDLVAEGHVYLAQPPLYKLKWQRGEPGFAYSDEERDEQLNEGLAAGRKINKDDGIQRYKGLGEMNASEL
PF00204         ----------------------------------------------------------------------
PF00986         --------------------------------------------------kkkveiqRfKGLGEMnpeqL
PF02518         ----------------------------------------------------------------------
PF01751         Ge--------------------------------------------------------------------


                         -         +         -         -         -         -         *:700
query           WETTMDPTVRILRRVDITDAQRADELFSILMGDDVVARRSFITRNAKDVRFLDI----------------
PF00204         ----------------------------------------------------------------------
PF00986         weTTmdpetRtllrvtiedaeeaeelfetLmGkeveaRrefi----------------------------
PF02518         ----------------------------------------------------------------------
PF01751         ----------------------------------------------------------------------