[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cglu2:BAF52976.1


[Show Plain Result]

## Summary of Sequence Search
   1::398
  13::325  PF00324 0.0% 21.2837837837838  Amino acid permease 
   1::398


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MYGLFGFSLSAAIAAWTGVAIPWWIVGLVGWVFVALMGVSNVELSAKVLGVLVALEFLVAIVVMIVALIH
PF00324         ------------iqfwelvsdlpkawvtgsvigavfivilliinlvgvkvygeaefilalikviaiiafi


                         -         -         *         -         -         -         -:140
query           SPEGISTATLHAEDFFVPGIGVLLAFSIAAFMGFESGAIYSEETKDPSKTVSRATYIAVGIIAIFYAAST
PF00324         ivgviillaggkpnkgrslgyngslkanfppgfakeetgafagfisvfvivffaftGielvaiiagEvkn


                         +         -         -         -         -         *         -:210
query           WALAMGVGPSAIIDESRIYGPDLVFVWLASFSPALSNVAHLLFVTSILAALLAFHNAAARYFFALGRSKV
PF00324         PekaiPkailqaviritifYvlsllaigllvprndlglladsasaaspfvifqkssgisvlaplinavil


                         -         -         -         +         -         -         -:280
query           IPSVFGKLGKNGAPIGGSIAQSVVGLVVVIVFAIGGANSTLGELFPVTTLFTWFSTAAAFGLVFLMAITS
PF00324         taalsaansslysasRvlyalakdglaPkkflkkvsksgvPlraillsmiisllal.........llasl


                         -         *         -         -         -         -         +:350
query           VAVLFWFRRNHHGYGVFTRVIAPGAAALFLVVIAVLILMNFDIMIGEESPRAMIFIMPGIIIGTGVLGAL
PF00324         nla........ivfnfllaisalinlivwlliilsylrfRkafky-------------------------


                         -         -         -         -         *         -         -:420
query           WSLRFDREIDVNAIPIAETAVVDESGTGSNAGSNAEDTQASSPAHTTI----------------------
PF00324         ----------------------------------------------------------------------