[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cglu2:BAF53009.1


[Show Plain Result]

## Summary of Sequence Search
   1::190
  25::188  PF00160 0.0% 47.5862068965517  Cyclophilin type peptidyl-prolyl cis-trans isomeras 
   1::190


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MGHVVGISLDVVMMGVMTSKTATAILHTNRGDITIDLFGNHAPETVANFVGLAQGTKEYQAQNAQGDSEG
PF00160         ------------------------dietsskGrivieLfedkaPktvenFlklak.......eg......


                         -         -         *         -         -         -         -:140
query           PFYNGSVFHRVIDGFMIQGGDPTGTGRGGPGYTFADEFHPELRFDRAYLLAMANAGPGTNGSQFFITVTP
PF00160         ..fYdgtkfhrvikgfmiqgGdpsgkgsngeeekaggesipdEikkkklkhkrGalamartgpepnsngs


                         +         -         -         -         -         *         -:210
query           TPHLNNAHTIFGEVTDAESQKVVDAIATTATDRYDRPADAVVIESVEITA--------------------
PF00160         qFfItlgdaphlDgkytvFGkVv..egmdvvekieavetde..kpekn----------------------