[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cglu2:BAF53115.1


[Show Plain Result]

## Summary of Sequence Search
   1::383
 235::340  PF00665 0.0% 21.6981132075472  Integrase core domain 
  78::101  PF08281 0.0% 45.8333333333333  Sigma-70, region 4 
 145::159  PF08281 0.0% 40  Sigma-70, region 4 
   1::383


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MAKIGRPGLPQDQRQKVWDLWKTGSSISDISRDVGSPPGSIFSILLPRGGIYLPAQKHHPGTLTLAEREE
PF00665         ----------------------------------------------------------------------
PF08281         ----------------------------------------------------------------------
PF08281         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           ISRGLSVGLSYRAIARLTGRSASTISREVTRNRGRTAYRAIDADDRSWRQARRPQRCKLAKNPVLRGYVA
PF00665         ----------------------------------------------------------------------
PF08281         -------glsykEIAellgisegtVksrlsR---------------------------------------
PF08281         -------glsykEIAellgisegtVksrlsR---------------------------------------


                         +         -         -         -         -         *         -:210
query           ARLREDWSPEQIAGRLKITYACTSRMQISHESIYKSLFIQSRGVLPKDLQKHLRSRRPIRKARSNTTSGQ
PF00665         ----------------------------------------------------------------------
PF08281         ----eglsykEIAellgis---------------------------------------------------
PF08281         ----eglsykEIAellgis---------------------------------------------------


                         -         -         -         +         -         -         -:280
query           WRSQIKDAVSISKRPKEAEARVQVGHWEGDLVIGAQQSQIATVIERATRFTRVVHVESRHAASVTAGLIR
PF00665         ------------------------elwqiDvtpgripskggkaylltaiddfsrfivaealkdessaetv
PF08281         ----------------------------------------------------------------------
PF08281         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           ELGQLPDQAKRSLTWDRGMELAGHKEVTAGTGMTVCFADPHSPWQRGTNENTNRLLRQYFPKKTSMKGFS
PF00665         adlleraverrggvepkrllsDngseftskafeallkelgirhkftrpyrpqdngkvErf----------
PF08281         ----------------------------------------------------------------------
PF08281         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           QTDLDQVADKLNNRPRKVLGFRTPAEQYEALLR-------------------------------------
PF00665         ----------------------------------------------------------------------
PF08281         ----------------------------------------------------------------------
PF08281         ----------------------------------------------------------------------