[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cglu2:BAF53177.1


[Show Plain Result]

## Summary of Sequence Search
   1::136
   1::115  PF02261 0.0% 60  Aspartate decarboxylase 
   1::136


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MLRTILGSKIHRATVTQADLDYVGSVTIDADLVHAAGLIEGEKVAIVDITNGARLETYVIVGDAGTGNIC
PF02261         mlrtllkskihratvteaelnYeGSitideelleaagilelekvqivnvnnGeRleTYvikgergsgvis


                         -         -         *         -         -         -         -:140
query           INGAAAHLINPGDLVIIMSYLQATDAEAKAYEPKIVHVDADNRIVALGNDLAEALPGSGLLTSRSI----
PF02261         lnGaaArlvqvgdlviiiayaqleeeeakklkpkvvlvdeknkik-------------------------