[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cglu2:BAF53395.1


[Show Plain Result]

## Summary of Sequence Search
   1::188
 148::184  PF05901 0.0% 40.5405405405405  Excalibur calcium-binding domain 
   1::188


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTARVKMISMRKTIITMLATTAIAFSAISPVQAQTVDTDTDASVSSELSSGTSSGSSEDSEDSDLSNRDI
PF05901         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           IFGVAAIAAVGGLIAGGVHWAVQQRMIPNPLPGIIPNPPALAPQAPAPAPAPAPAPQAVAPQAVAPAPAP
PF05901         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           APVQTNRTYKNCTEVWNVLGRSIRQGEPGYGTHLDRDRDGIGCESRPR----------------------
PF05901         -------afknCtemrkkykagvykkdtkykaylDrDkDGiACE--------------------------