[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cglu2:BAF53422.1


[Show Plain Result]

## Summary of Sequence Search
   1::100
  13::97   PF02583 0.0% 48.8095238095238  Uncharacterised BCR, COG1937 
   1::100


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSNSECHTHGYIEEKQRYLARLKRIEGQTRGIHRMIDEEQYCIDILTQISAVNSALKNVAFGLLDDHLAH
PF02583         ------------eekkkllkRLrrieGQvrgiermieedrdCedilqQiaAvrsAlnkvgkllleehlke


                         -         -         *         -         -         -         -:140
query           CVKEAADLGGDELDAKLKEVSDAIARFSKA----------------------------------------
PF02583         cvaeaies.eeereekieellkllkky-------------------------------------------