[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cglu2:BAF53444.1


[Show Plain Result]

## Summary of Sequence Search
   1::302
  13::297  PF02541 0.0% 34.0501792114695  Ppx/GppA phosphatase family 
   1::302


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MGSNTVHLVAVDARPGGHPTPMSNWRTPLRLVELLDDSGAISEKGINKLTSAVGEAADLAKTLGCAELMP
PF02541         ------------rkaagllqivarekrkvrLaeglnesgrlqeeaiertisaLkefaeilqkfkvenvrv


                         -         -         *         -         -         -         -:140
query           FATSAVRSATNSEAVLDHVEEETGVRLSILSGEDEARQTFLAVRRWYGWSAGRITNLDIGGGSLELSSGT
PF02541         VATsalRdavNadeFlarvkkelglkveiisgeeEarliylgvvssl.lekgrglviDiGGGStElvlge


                         +         -         -         -         -         *         -:210
query           DESPDLAFSLDLGAGRLTHNWFDTDPPARKKINLLRDYIDAELAEPARQMRTLGPARLAVGTSKTFRTLA
PF02541         ekevsklvSlplGavrlterfltddpltkeeveaarkavekeleevkdevkkegewtrlvgtsgtisala


                         -         -         -         +         -         -         -:280
query           RLTGAAPSSAGPHVTRTLTAPGLRQLIAFISRMTAADRAELEGISSDRSHQIVAGALVAEAAMRALDIDK
PF02541         eltelhgek.....gyeitaeeleeliekllqlkkeeelklagvsdeRadvivagalilsavlealeiea


                         -         *         -         -         -         -         +:350
query           VEICPWALREGVILTRIDKGLE------------------------------------------------
PF02541         viisegalrEGvlysll-----------------------------------------------------