[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cglu2:BAF53610.1


[Show Plain Result]

## Summary of Sequence Search
   1::211
  45::108  PF00333 0.0% 60.9375  Ribosomal protein S5, N-terminal domain 
 118::191  PF03719 0.0% 64.8648648648649  Ribosomal protein S5, C-terminal domain 
   1::211


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MPGRERRDGGRSADDNKQNDRNERRGGGRRDDRRNQQQDERSQYIERVVTINRVSKVVKGGRRFSFTALV
PF00333         --------------------------------------------eekvlkikrVskvtkgGrrlrFkAlv
PF03719         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           IVGDGKGMVGVGYGKAKEVPAAIQKGAEEARKNFFRVPMVNGTITHPVQGEKAAGIVMLKPAAPGTGVIA
PF00333         vVGdknGrvGlGvgkakevaeAIrkAieeAkknlievr--------------------------------
PF03719         -----------------------------------------------vegkfgavkVllkpAprGtGiiA


                         +         -         -         -         -         *         -:210
query           GGAARPVLECAGIQDILSKSLGSDNAINVVHATVDGLKQLVRPEEVAARRGKTIEEVAPARILRARAGQE
PF00333         ----------------------------------------------------------------------
PF03719         ggavravlelaGikDvlakslgsrnpinvvkAtfeALkklrtpeevaakrg-------------------


                         -         -         -         +         -         -         -:280
query           A---------------------------------------------------------------------
PF00333         ----------------------------------------------------------------------
PF03719         ----------------------------------------------------------------------