[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cglu2:BAF53649.1


[Show Plain Result]

## Summary of Sequence Search
   1::317
   4::238  PF01370 0.0% 33.4821428571429  NAD dependent epimerase/dehydratase family 
   1::271  PF04321 0.0% 24.5833333333333  RmlD substrate binding domain 
   4::221  PF01073 0.0% 24.6445497630332  3-beta hydroxysteroid dehydrogenase/isomerase famil 
   5::29   PF07993 0.0% 36  Male sterility protein 
  46::186  PF07993 0.0% 26.5151515151515  Male sterility protein 
   4::116  PF02719 0.0% 29.2035398230088  Polysaccharide biosynthesis protein 
 145::220  PF02719 0.0% 30.1369863013699  Polysaccharide biosynthesis protein 
   3::60   PF00106 0.0% 24.1379310344828  short chain dehydrogenase 
   1::317


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MRCVITGGAGFLGSHLTDLILNQGHEVIVLDDLSTGSLSNLFHQISNPRLQIKTVDVRKKFEIDGPVDIV
PF01370         ---lVtGgtGfiGsalveallekgyevv..dnlirrtrseelaterl.rvelvegdltdkdalerlfaee
PF04321         mrilvtGanGqlGteLaralkeegvevvaldre...............eldltdpeavaalvkeakpdvv
PF01073         ---lVtGgsGFlGrrlvreLleleelkevrvldlrespelleelsklqvkt..vlegDvtdkekleeale
PF07993         ----lTGaTGfLGkvllekllrtqpevki----------------seprlgLseedlq...elaeevdvi
PF07993         ----lTGaTGfLGkvllekllrtqpevki----------------seprlgLseedlq...elaeevdvi
PF02719         ---lvtGagGSiGselvrqilkkkpkkiillersElklyeiekelkleeelkkeklkveivpvlgdvrdk
PF02719         ---lvtGagGSiGselvrqilkkkpkkiillersElklyeiekelkleeelkkeklkveivpvlgdvrdk
PF00106         --vliTGGlgglGlalArwLveegarhlvlvsrredapgaaeliaelealgaevtvvacD----------


                         -         -         *         -         -         -         -:140
query           FNLASPASPPVYTQRRVECLLINSEAVLQVAEFALEKGARLVQASTSEVYGDPLSHPQLEHHWGNVNPIG
PF01370         .qpdaVihlaaesgvdassedpadfiennvvgtlnlleaarkagvkrlvflsSsevYgkd.aeepikEet
PF04321         vnaAAytavdkaEseeeeayavnaegpenlAeaaaavgallihiSTdyVFdGe.....kkrpYeeddeta
PF01073         gvdvvihtaa.iidvlgkaerdeilkvnvkGTqnvleacvkagvrvlvYtSsaevvgpnvkgqeilnGdE
PF07993         ihsAAtvn...feepykellrtNvlGtrevlelakklkklvllhvSTavvageregeveekvyeeeeder
PF07993         ihsAAtvn...feepykellrtNvlGtrevlelakklkklvllhvSTavvageregeveekvyeeeeder
PF02719         erleealeelkvdvvfhaAAlKhVplveenpleavktNvlgtenvi------------------------
PF02719         erleealeelkvdvvfhaAAlKhVplveenpleavktNvlgtenvi------------------------
PF00106         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           ERSCYDEGKRFAEALLSAMRLEQGLNAGIIRIFNTYGPRMHPFDGRVISGFVRQALANEPLTVFGDGSQT
PF01370         plgplsp......YaaaKlageklveayareyglraiilrlfnvyGprnfdeeetkvipalirrilegee
PF04321         PlnvYGrtKlaGEqavla....anpkalivRtawvygekgknf....vktmlrlaaereelkvvaD..ql
PF01073         etpyesthkdaYaesKalAEklvlkangrtlknggrllTcAlRpagiyGegdk....llvraleellksg
PF07993         aklkglpntYtqsKalaEklvreasrrsglpvviiRpsiivg...e------------------------
PF07993         aklkglpntYtqsKalaEklvreasrrsglpvviiRpsiivg...e------------------------
PF02719         ----mGatKrlaekllqalaeeseekk.tkfvvvRfGNVlgS.rGSviplFkkqikeggpvtv.Tdpeit
PF02719         ----mGatKrlaekllqalaeeseekk.tkfvvvRfGNVlgS.rGSviplFkkqikeggpvtv.Tdpeit
PF00106         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           RSFCYVSDLVRGLWLMGNSNQPGPINLGNPIEQTVLSMAHLIKESTNSESSITFEPLPSDDPVRRRPDIS
PF01370         eltllgdGtqlRdflyveDvaraillal------------------------------------------
PF04321         gsPTsaedlAdvllallekaaeeealagvyHlansgetswfdfAraifkelgadg.eevkp---------
PF01073         lallkigekev-----------------------------------------------------------
PF07993         ----------------------------------------------------------------------
PF07993         ----------------------------------------------------------------------
PF02719         Ryfmtieeav------------------------------------------------------------
PF02719         Ryfmtieeav------------------------------------------------------------
PF00106         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           KAKELLGWEPLVGIDVGLREVINWQIETQRTYAEKIS---------------------------------
PF01370         ----------------------------------------------------------------------
PF04321         ----------------------------------------------------------------------
PF01073         ----------------------------------------------------------------------
PF07993         ----------------------------------------------------------------------
PF07993         ----------------------------------------------------------------------
PF02719         ----------------------------------------------------------------------
PF02719         ----------------------------------------------------------------------
PF00106         ----------------------------------------------------------------------