[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cglu2:BAF53730.1


[Show Plain Result]

## Summary of Sequence Search
   1::266
  45::204  PF04307 0.0% 39.0625  Predicted membrane-bound metal-dependent hydrolase 
   1::266


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MVMGPTHAMSGAAVGLAVAQILPAEWGGVTTATEAFIYAGLAAGAALLPDLDSPQATVSRSFGPITQVIS
PF04307         --------------------------------------------gallPDiDhplllkalvkstisrelg


                         -         -         *         -         -         -         -:140
query           RFTENICQTFVNVTRGRKDKHCNNGHRTLTHTVWSAAATGAGATALIGTYGKPAVIGLLFFFLGLAIRGL
PF04307         l.ss.a..........................HRgftHsllfallla.......................


                         +         -         -         -         -         *         -:210
query           MPEWSKNADWLLVTGASAALAVGVWNYAPESSFGIVLGSAITVGSLTHLAGDMATKAGIPAFAPVIPLKG
PF04307         ...........................llllllf..................falgylsHlllD------


                         -         -         -         +         -         -         -:280
query           KRWWNLKLPKFLSIRANGPADKFLLFVFSVAVIIQIGLVSSGNMSTIMMNLLSPAL--------------
PF04307         ----------------------------------------------------------------------