[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cglu2:BAF53734.1


[Show Plain Result]

## Summary of Sequence Search
   1::157
   6::145  PF00588 0.0% 29.9270072992701  SpoU rRNA Methylase family 
   1::157


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MPEHPLHVIFDNPVIPPNTGNAIRMCAGTGAHLHLVEPLGFELTEKHLRRAGLDYHDLADVTVHATFDEA
PF00588         -----livvldeiedpgNlGaiaRtaaafgaselilvkprsvdllnkkakrasagalellelkvvdslee


                         -         -         *         -         -         -         -:140
query           MAAVPGRVFAFTTTANTRFTDIAFEPGDALLFGTEPTGLPQEHVEHSRITSELRIPMLPGRRSMNLSNSA
PF00588         alkdlkeeglkviatsl.kgkslreielkekvalvfGnEdkGlsnellekad..elvkIpmsgeveSLNv


                         +         -         -         -         -         *         -:210
query           AVATYEAWRQLGFVGGV-----------------------------------------------------
PF00588         avAva-----------------------------------------------------------------