[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cglu2:BAF53744.1


[Show Plain Result]

## Summary of Sequence Search
   1::106
   1::73   PF06267 0.0% 42.4657534246575  Family of unknown function (DUF1028) 
   1::106


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MLKDPVVIEKMIQAFESSEGELETRLMGAMLAGLNAGGEAGPVHSAGIAVARSSGWAETDLRIDWSDQPI
PF06267         lLageeVleamaeaFeaatgeelaerLlaALeageaaGgdargeqSAallvvkeeeyplvdlrvddsedp


                         -         -         *         -         -         -         -:140
query           EDLSKLLQEWLIQRDDYVIRGIDPSKSPAYGVPGDE----------------------------------
PF06267         iee-------------------------------------------------------------------