[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cglu2:BAF53786.1


[Show Plain Result]

## Summary of Sequence Search
   1::498
  17::473  PF03972 0.0% 31.9444444444444  MmgE/PrpD family 
   1::498


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MRIHDVYTHLSADNFPKAEHLAWKISELATDPVEVTPDVSEMIINRIIDNAAVSAASVLRRPVTVARQQA
PF03972         ----------------vleeladyvaevrissipe..ealetvkklllDtlgaalaaleeppvtallkiv


                         -         -         *         -         -         -         -:140
query           QSHPREKGGKVFGISGSYSPEWAAFANGVAVRELDFHDTFLAAEYSHPGDNIPPLLAVAQAQRSSGRDLI
PF03972         lgtlvrggakvlgtskrlspvqAAfanGaaaraLDydDthlaaeghhpsdniPailAvAealgaslvkev


                         +         -         -         -         -         *         -:210
query           RGIATAYEVQVELVKGICLHEHKIDHVAHLGPSAAAGLGTLLHVDEETIYQAIGQALHTTTATRQSRKGE
PF03972         leaivvayEiairlAeenslrrvgldhvtlvkvaaAAavakllgldreeienAlsiAgtdgaslrttrha


                         -         -         -         +         -         -         -:280
query           ISSWKAFAPAFAGKMAIEAMDRAMRGEGSPAPIWEGEDGVIAWLLSGKDHVYHVPLPEHGEPKLGILETY
PF03972         klsgskkeaaadatsagllaadlAakgetGpsdlldgeegfkkvllkgeklele.kplg....syavenv


                         -         *         -         -         -         -         +:350
query           TKEHSAEYQSQAPIDLARRMKPLVDAAGGTEHIAEIVLRTSHHTHYVIGTGANDPQKMDPQASRETLDHS
PF03972         lfKpypaerhahsAidAalalreeekdr..adeIesieietfevAiriinkrg.......ppankedadh


                         -         -         -         -         *         -         -:420
query           IMYIFAVALQDGVWHHEFSYTRKRSTRPETVELWHKIRTVEDPEWTRRYHSDDPAKKAFGAKAVITMADG
PF03972         SlpyiiAvallkGelale.dyedevladsridalaekielrvdpefdeay....pakrsi...arvvldd


                         -         -         +         -         -         -         -:490
query           TLIEDELAVADAHPLGARPFARENYIEKFRTLAQGIVIDSEQERFLHAVQSLPDLDDLDQLNIEVDISNQ
PF03972         gtrveeeeveyPkGh.prnplsrddlveKfrrllaelveeskqereliikeal-----------------


                         *         -         -         -         -         +         -:560
query           AATKAGLL--------------------------------------------------------------
PF03972         ----------------------------------------------------------------------