[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cglu2:BAF53863.1


[Show Plain Result]

## Summary of Sequence Search
   1::197
  49::88   PF01863 0.0% 30  Protein of unknown function DUF45 
  91::192  PF01863 0.0% 35.6435643564356  Protein of unknown function DUF45 
 103::182  PF10263 0.0% 25  SprT-like family 
   1::197


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MCHLKNFPQNLIDTVTSSGLISSQLQSSVMQEKPEMPAIEVIRSAKRTKTVQARIVDGQIQVRIPARMSK
PF01863         ------------------------------------------------ktlslrvepdgsvevsaPkgvs
PF01863         ------------------------------------------------ktlslrvepdgsvevsaPkgvs
PF10263         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           AEEEKAVGEIVAKLKRRTRSAVSSDADLIERAHKLNKTVLEGRARVESIRWVSNQKGRWGSCTVATAEIR
PF01863         eeeieefveekakwikkk--aeklrkaleewlkkeakeeleerlakyaeklgvevksvrirdmksrWGsc
PF01863         eeeieefveekakwikkk--aeklrkaleewlkkeakeeleerlakyaeklgvevksvrirdmksrWGsc
PF10263         --------------------------------eelndalfggqlskvkvtwskrlnttaGranlkresha


                         +         -         -         -         -         *         -:210
query           ISDRLKHVPDYVLDAVLVHELTHTFIAGHSAEFWEWADKTPLAERAKGYLEAYQRWG-------------
PF01863         .sskgkirlnlrLvkapkevidYVvvHElaHllemnHskrFwalvekllPdw------------------
PF01863         .sskgkirlnlrLvkapkevidYVvvHElaHllemnHskrFwalvekllPdw------------------
PF10263         sIeLsekllderseerllntLlHEmiHlalfvisngrrnpHg----------------------------